Rv1882c Family assigned · medium auto-curated

H37Rv Rv1882c · MTBC0 mtbc0_001996 · 277 aa · 2150409–2151242 (-) · RefSeq NP_216398.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)short-chain type dehydrogenase/reductase
MTBC0 PGAP re-annotationSDR family oxidoreductase
Revised (this work)SDR family oxidoreductase. Pfam: adh_short (PF00106.32), adh_short_C2 (PF13561.13).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O07749 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable short-chain type dehydrogenase/reductase

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
Q Secondary metabolites biosynthesis, transport and catabolism
eggNOG descriptionBelongs to the short-chain dehydrogenases reductases (SDR) family
Orthologous groupCOG1028

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.669 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
adh_shortPF00106.32 1.2e-432–194 short chain dehydrogenase
adh_short_C2PF13561.13 2.3e-328–194 Enoyl-(Acyl carrier protein) reductase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: cyp140 (cytochrome P450 Cyp140), high confidence from genomic context alone (score 772 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1883c hyp hypothetical protein 866 866 ctx neighborhood:844
Rv1880c cyp140 cytochrome P450 Cyp140 772 772 ctx neighborhood:771
Rv1881c lppE lipoprotein LppE 702 702 ctx neighborhood:688
Rv1714 oxidoreductase 698 699 ctx cooccurence:688
Rv3485c short-chain type dehydrogenase/reductase 689 690 ctx cooccurence:673
Rv2766c short-chain type dehydrogenase/reductase 681 682 ctx cooccurence:675
Rv1884c rpfC resuscitation-promoting factor RpfC 658 648 ctx neighborhood:606
Rv1543 oxidoreductase 583 583 ctx cooccurence:573
Rv1885c chorismate mutase 582 583 ctx neighborhood:577
Rv1006 hyp hypothetical protein 579 579 ctx cooccurence:573
Rv3549c short-chain type dehydrogenase/reductase 576 577 ctx cooccurence:565
Rv3530c oxidoreductase 575 575 ctx cooccurence:566
Rv1886c fbpB diacylglycerol acyltransferase/mycolyltransferase Ag85B 566 566 ctx neighborhood:561
Rv2509 cmrA short-chain type dehydrogenase/reductase 553 553 ctx cooccurence:544
Rv0547c oxidoreductase 552 552 ctx cooccurence:542

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: short-chain type dehydrogenase/reductase
  • MTBC0 PGAP product: SDR family oxidoreductase
  • Pfam (hmmscan --cut_ga): adh_short PF00106.32 (E=1e-43), adh_short_C2 PF13561.13 (E=2e-32)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216398.1)
  • Domains: Pfam-A via hmmscan --cut_ga — adh_short (PF00106.32), adh_short_C2 (PF13561.13)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1028
  • Curated reference: UniProt O07749 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 22 functional partner(s); context anchor cyp140
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001996|Rv1882c|
MKAIFITGAGSGMGREGATLFHANGWRVGAIDRNEDGLAALRVQLGAERLWARAVDVTDKAALEGALADFCAGNVGGGLDMMWNNAGIGEGGWFEDVPYEAAVRVVDVNFKAVLTGAYAALPYLKKAPGSLMFSTSSSSGTYGMPRIAVYSATKHAVKGLTEALSVEWQRHGVRVADVLPGLIDTAILTSTRQHSDEGPYTISAEQIRAAAPKKGMFRLMPSSSVAEAAWRAYQHPTRLHWYVPRSIRWIDRLKGVSPEFVRRHIAKSLATLEPKRK