Rv1873 Family assigned · medium

H37Rv Rv1873 · MTBC0 mtbc0_001986 · 145 aa · 2141213–2141650 (+) · RefSeq NP_216389.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationDUF1810 domain-containing protein
Revised (this work)Conserved hypothetical protein with an X-ray crystal structure at 1.38 A: a 16.2 kDa monomer adopting a primarily alpha-helical fold with limited similarity to known structures (COG5579). Not a novel fold but a model for sequence-related orthologues. Function unknown. (The UniProt auto-name 'Calpastatin' is a database artefact and is not adopted.)

Curated reference (UniProt)

UniProt O07756 TrEMBL · unreviewed · Evidence at protein level
UniProt nameCalpastatin

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionProtein of unknown function (DUF1810)
Orthologous groupCOG5579

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.436 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 4 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.84% of strains (1217) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF1810PF08837.17 1.6e-577–142 Protein of unknown function (DUF1810)

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 89.4 (confident). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
2jek-assembly1_A 1.00 0.99 1.7e-19 sig 2jek-assembly1_A Crystal structure of the conserved hypothetical protein Rv1873 from Mycobacterium tuberculosis at 1.38 A
2nc9-assembly1_A 0.06 0.32 6.0e+00 2nc9-assembly1_A Apo solution structure of Hop TPR2A
4gcn-assembly2_B 0.05 0.28 4.2e+00 4gcn-assembly2_B N-terminal domain of stress-induced protein-1 (STI-1) from C.elegans
6oiu-assembly3_C 0.04 0.23 3.6e+00 6oiu-assembly3_C X-ray crystal structure of the ectodomain of the Toxoplasma gondii ME49 Aminopeptidase N (TGME49_224350)
5l0y-assembly3_C 0.03 0.25 7.6e+00 5l0y-assembly3_C Crystal Structure of a Sec72-ssa1 c-terminal peptide fusion protein
7ep2-assembly1_B 0.03 0.30 8.9e+00 7ep2-assembly1_B Crystal structure of ZYG11B bound to GGFN degron
6oiu-assembly4_D 0.03 0.23 6.0e+00 6oiu-assembly4_D X-ray crystal structure of the ectodomain of the Toxoplasma gondii ME49 Aminopeptidase N (TGME49_224350)
4iwb-assembly1_A 0.03 0.16 2.8e+00 4iwb-assembly1_A Novel Fold of FliC/FliS Fusion Protein

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: lldD2 (L-lactate dehydrogenase), high confidence from genomic context alone (score 790 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1872c lldD2 L-lactate dehydrogenase 790 790 ctx neighborhood:790
Rv1874 hyp hypothetical protein 596 596 ctx neighborhood:593
Rv1875 hyp hypothetical protein 582 583 ctx neighborhood:580
Rv1871c hyp hypothetical protein 556 556 ctx neighborhood:556
Rv1870c hyp hypothetical protein 443 443 ctx neighborhood:441

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • X-ray crystal structure 1.38 A; alpha-helical fold; COG5579 (Garen 2006, PMID 17142896)
  • Limited structural similarity to a repeated motif of other proteins
  • Curated from the literature crible (project 'Still unknown gene function', 2026-06-09)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216389.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF1810 (PF08837.17)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG5579
  • Curated reference: UniProt O07756 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 89.4, confident)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 5 functional partner(s); context anchor lldD2
  • Primary literature: Garen CR, Cherney MM, Bergmann EM, James MN (2006). The molecular structure of Rv1873, a conserved hypothetical protein from Mycobacterium tuberculosis, at 1.38 A resolution Acta Crystallogr F 62(Pt 12):1201-5. doi:10.1107/S1744309106046902 PMID:17142896

Ancestral MTBC0 protein sequence

>mtbc0_001986|Rv1873|
MKSASDPFDLKRFVYAQAPVYRSVVEELRAGRKRGHWMWFVFPQLRGLGSSPLAVRYGISSLEEAQAYLQHDLLGPRLHECTGLVNQVQGRSIEEIFGPPDDLKLCSSMTLFARATDANQDFVALLAKYYGGGEDRRTVALLAVT