dtd Resolved · high auto-curated

H37Rv Rv1897c · MTBC0 mtbc0_002011 · 143 aa · 2162516–2162947 (-) · RefSeq NP_216413.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)D-tyrosyl-tRNA(Tyr) deacylase
MTBC0 PGAP re-annotationD-aminoacyl-tRNA deacylase
Revised (this work)D-aminoacyl-tRNA deacylase. Pfam: Tyr_Deacylase (PF02580.22).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WNS9 SwissProt · reviewed · Evidence at protein level
UniProt nameD-aminoacyl-tRNA deacylase
EC (curated) EC 3.1.1.96
Curated functionAn aminoacyl-tRNA editing enzyme that deacylates mischarged D-aminoacyl-tRNAs. Also deacylates mischarged glycyl-tRNA(Ala), protecting cells against glycine mischarging by AlaRS. Acts via tRNA-based rather than protein-based catalysis; rejects L-amino acids rather than detecting D-amino acids in the active site. By recycling D-aminoacyl-tRNA to D-amino acids and free tRNA molecules, this enzyme counteracts the toxicity associated with the formation of D-aminoacyl-tRNA entities in vivo and helps enforce protein L-homochirality.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred namedtd
eggNOG descriptionrejects L-amino acids rather than detecting D-amino acids in the active site. By recycling D-aminoacyl-tRNA to D-amino acids and free tRNA molecules, this enzyme counteracts the toxicity associated with the formation of D-aminoacyl-tRNA entities in vivo and helps enforce protein L-homochirality
Orthologous groupCOG1490
KEGG orthology K07560
Gene Ontology (37) GO:0002161, GO:0003674, GO:0003824, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0006139, GO:0006399, GO:0006450, GO:0006725, GO:0006807 +25 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.468 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Tyr_DeacylasePF02580.22 1.2e-472–142 D-Tyr-tRNA(Tyr) deacylase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1896c (S-adenosyl-L-methionine-dependent methyltransferase), high confidence from genomic context alone (score 883 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1896c S-adenosyl-L-methionine-dependent methyltransferase 883 883 ctx neighborhood:882
Rv1898 hyp hypothetical protein 786 787 ctx neighborhood:787
Rv1364c sigma factor regulatory protein 544 544 ctx neighborhood:544
Rv2583c relA bifunctional (p)ppGpp synthase/hydrolase RelA 478 479 coexpression:436
Rv3013 hyp hypothetical protein 461 461 coexpression:430
Rv0702 rplD 50S ribosomal protein L4 615 149 textmining:567

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: D-tyrosyl-tRNA(Tyr) deacylase
  • MTBC0 PGAP product: D-aminoacyl-tRNA deacylase
  • Pfam (hmmscan --cut_ga): Tyr_Deacylase PF02580.22 (E=1e-47)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216413.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Tyr_Deacylase (PF02580.22)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1490
  • Curated reference: UniProt P9WNS9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 6 functional partner(s); context anchor Rv1896c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002011|Rv1897c|dtd
MRVLVQRVSSAAVRVDGRVVGAIRPDGQGLVAFVGVTHGDDLDKARRLAEKLWNLRVLADEKSASDMHAPILVISQFTLYADTAKGRRPSWNAAAPGAVAQPLIAAFAAALRQLGAHVEAGVFGAHMQVELVNDGPVTVMLEG