mtrA Resolved · high auto-curated

H37Rv Rv3246c · MTBC0 mtbc0_003454 · 228 aa · 3648806–3649492 (-) · RefSeq NP_217763.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)two component DNA-binding response regulator MtrA
MTBC0 PGAP re-annotationtwo-component system response regulator MtrA
Revised (this work)Two-component system response regulator MtrA. Pfam: Response_reg (PF00072.31), Trans_reg_C (PF00486.35).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WGM7 SwissProt · reviewed · Evidence at protein level
UniProt nameDNA-binding response regulator MtrA
Curated functionMember of the two-component regulatory system MtrA/MtrB. Binds direct repeat motifs of sequence 5'-GTCACAGCG-3', phosphorylation confers higher affinity. Overexpression decreases bacteria viability upon infection of human THP-1 macrophage cell line, due at least in part to impaired blockage of phagosome-lysosome fusion (upon infection bacteria usually remain in phagosomes). Infecting C57BL/6 mice with an overexpressing strain leads to an attentuated infection in both spleen and lungs. The level of dnaA mRNA increases dramatically. Binds the promoter of dnaA, fbpD, ripA and itself, as well as o.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
Preferred namemtrA
eggNOG descriptionresponse regulator
Orthologous groupCOG0745
KEGG orthology K07670
KEGG pathways map02020
KEGG modules M00461
Gene Ontology (65) GO:0005575, GO:0005623, GO:0005886, GO:0006355, GO:0006464, GO:0006468, GO:0006793, GO:0006796, GO:0006807, GO:0008150, GO:0008152, GO:0009889 +53 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Response_regPF00072.31 2.8e-308–117 Response regulator receiver domain
Trans_reg_CPF00486.35 1.2e-26149–224 Transcriptional regulatory protein, C terminal

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: mtrB (two component sensory histidine kinase MtrB), high confidence from genomic context alone (score 995 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3245c mtrB two component sensory histidine kinase MtrB 999 995 ctx neighborhood:693 cooccurence:724 database:900 textmining:965
Rv0600c two component sensor kinase HK1 912 897 ctx cooccurence:767
Rv1032c trcS two component sensor histidine kinase TrcS 892 877 ctx cooccurence:719
Rv0490 senX3 two component sensor histidine kinase SenX3 948 871 ctx cooccurence:764 textmining:620
Rv3764c tcrY two component sensor kinase TcrY 885 870 ctx cooccurence:703
Rv0902c prrB two component sensor histidine kinase PrrB 953 866 ctx cooccurence:694 textmining:666
Rv0758 phoR two component system response sensor kinase PhoR 866 855 ctx cooccurence:746
Rv0982 mprB two component histidine-protein kinase/phosphatase MprB 866 843 ctx cooccurence:639
Rv3244c lpqB lipoprotein LpqB 936 820 ctx neighborhood:814 textmining:661
Rv3247c tmk thymidylate kinase 794 794 ctx neighborhood:794
Rv3243c hyp hypothetical protein 730 731 ctx neighborhood:729
Rv3248c sahH adenosylhomocysteinase 731 721 ctx neighborhood:719
Rv0601c two component sensor kinase HK2 687 637
Rv3242c hyp hypothetical protein 593 578 ctx neighborhood:556
Rv2998A Rv2998A, len: 67 aa. Probable conserved hypothetical protein, (possibly gene fragment), highly similar to central part of two-component sens 591 576

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: two component DNA-binding response regulator MtrA
  • MTBC0 PGAP product: two-component system response regulator MtrA
  • Pfam (hmmscan --cut_ga): Response_reg PF00072.31 (E=3e-30), Trans_reg_C PF00486.35 (E=1e-26)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217763.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Response_reg (PF00072.31), Trans_reg_C (PF00486.35)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0745
  • Curated reference: UniProt P9WGM7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 52 functional partner(s); context anchor mtrB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003454|Rv3246c|mtrA
MDTMRQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRPDLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGADDYIMKPFKPKELVARVRARLRRNDDEPAEMLSIADVEIDVPAHKVTRNGEQISLTPLEFDLLVALARKPRQVFTRDVLLEQVWGYRHPADTRLVNVHVQRLRAKVEKDPENPTVVLTVRGVGYKAGPP