glnX Resolved · high auto-curated

H37Rv Rv0412c · MTBC0 mtbc0_000432 · 439 aa · 501665–502984 (-) · RefSeq NP_214926.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)membrane protein
MTBC0 PGAP re-annotationprotein kinase G-activating protein GlnX
Revised (this work)Protein kinase G-activating protein GlnX. Pfam: Sensor_actino (PF28326.1).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P96258 TrEMBL · unreviewed · Evidence at protein level
UniProt namePossible conserved membrane protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category T Signal transduction mechanisms
eggNOG descriptionphosphoserine phosphatase activity
Orthologous groupCOG5278

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.498 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Sensor_actinoPF28326.1 1.8e-4365–199 Actinobacterial sensor domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: pknG (serine/threonine-protein kinase PknG), high confidence from genomic context alone (score 994 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0410c pknG serine/threonine-protein kinase PknG 994 994 ctx neighborhood:881 cooccurence:746 coexpression:815
Rv0411c glnH glutamine-binding lipoprotein GlnH 994 990 ctx neighborhood:881 cooccurence:451 coexpression:860 textmining:489
Rv0129c fbpC diacylglycerol acyltransferase/mycolyltransferase Ag85C 683 671 ctx cooccurence:445 coexpression:414
Rv1886c fbpB diacylglycerol acyltransferase/mycolyltransferase Ag85B 665 652 ctx cooccurence:420 coexpression:407
Rv0413 mutT3 8-oxo-dGTP diphosphatase 640 640 ctx neighborhood:635
Rv3804c fbpA diacylglycerol acyltransferase/mycolyltransferase Ag85A 645 631 coexpression:410
Rv2743c hyp hypothetical protein 630 631 ctx cooccurence:627
Rv0283 eccB3 ESX-3 secretion system protein EccB3 618 618 ctx cooccurence:607
Rv0383c ttfA hyp hypothetical protein 615 615 ctx cooccurence:603
Rv0996 transmembrane protein 594 594 ctx cooccurence:590
Rv0774c hyp hypothetical protein 608 593 coexpression:407
Rv3803c fbpD MPT51/MPB51 antigen 601 586 coexpression:407
Rv3655c hyp hypothetical protein 570 570 ctx cooccurence:570
Rv0290 eccD3 ESX-3 secretion system protein EccD 569 570 ctx cooccurence:567
Rv2695 hyp hypothetical protein 553 554 ctx cooccurence:544

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: membrane protein
  • MTBC0 PGAP product: protein kinase G-activating protein GlnX
  • Pfam (hmmscan --cut_ga): Sensor_actino PF28326.1 (E=2e-43)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214926.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Sensor_actino (PF28326.1)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG5278
  • Curated reference: UniProt P96258 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 56 functional partner(s); context anchor pknG
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000432|Rv0412c|glnX
MTVELAHPSTEPLGSRSPAEPAHPRRWFISTTPGRIMTIGIVLAALGVASAFATSTTIEHRQQVLTAVLDHTEPLSFAAGRLYTTLSVADAAAATAFIAQAEPGGVRLRYEQAITDASVAVTRASSGLTDESLVQLLGRINAELAVYTGLVEIARANNRAGNPVGSSYLSEASGLMQSTILPDAQRLYQATSARVDRETTASTQIPAPVILVVATTVVFGAFAHRWLARRTRRRINPGLVVGALGILVMVVWVGTALTISTTASRSAKDTAAESLKTITNLAITAQQARADETLSLIRRGDEEVRKQAFYQRIDAMQRQLNDYMARRHAVDKPDLQGADQLLVRWRQANDRINSYISVGNYRAATQVALGKGEDDATPAFDKLDEALTKAMGQSRTQLRHDILNAHRGLAGAQVGGVVLSLGAAIAVALGLWPRLKEYR