Rv1891 Still unknown · low auto-curated

H37Rv Rv1891 · MTBC0 mtbc0_002005 · 135 aa · 2157805–2158212 (+) · RefSeq NP_216407.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Conserved hypothetical protein; no recognised domain. Function unknown. Foldseek best (non-significant) hit: 6xl5-assembly1_D Cryo-EM structure of EcmrR-RNAP-promoter open complex (prob 0.04, TM 0.37).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O07741 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved protein

UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2ASSI

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.345 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 84.3 (confident). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
6xl5-assembly1_D 0.04 0.37 4.3e+00 6xl5-assembly1_D Cryo-EM structure of EcmrR-RNAP-promoter open complex (EcmrR-RPo)
7ade-assembly1_Y 0.03 0.36 6.1e+00 7ade-assembly1_Y Transcription termination complex IVa
6vhh-assembly1_A 0.03 0.23 2.1e+00 6vhh-assembly1_A Human Teneurin-2 and human Latrophilin-3 binary complex
1rwi-assembly1_B 0.02 0.23 2.0e+00 1rwi-assembly1_B Extracellular domain of Mycobacterium tuberculosis PknD
1rwl-assembly1_A 0.02 0.20 2.7e+00 1rwl-assembly1_A Extracellular domain of Mycobacterium tuberculosis PknD
4s20-assembly1_D 0.01 0.29 9.2e+00 4s20-assembly1_D Structural basis for transcription reactivation by RapA
7pgm-assembly1_C 0.01 0.29 9.7e+00 7pgm-assembly1_C HHIP-C in complex with heparin
7bam-assembly1_B 0.01 0.15 4.6e+00 7bam-assembly1_B human Teneurin4 WT C2

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1892 (membrane protein), high confidence from genomic context alone (score 962 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1892 membrane protein 962 962 ctx neighborhood:861 coexpression:740
Rv1893 hyp hypothetical protein 893 893 ctx neighborhood:856
Rv1890c hyp hypothetical protein 574 573 ctx neighborhood:573
Rv1889c Rv1889c, (MTCY180.29), len: 118 aa. Conserved hypothetical protein. Part of large family of Mycobacterium tuberculosis proteins with conserv 443 443 ctx neighborhood:443

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: hypothetical protein
  • Foldseek best: 6xl5-assembly1_D Cryo-EM structure of EcmrR-RNAP-promoter open complex (EcmrR-RP (prob 0.04, E=4e+00, TM=0.37)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216407.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2ASSI
  • Curated reference: UniProt O07741 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 84.3, confident)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 4 functional partner(s); context anchor Rv1892
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002005|Rv1891|
MIRELVTTAAITGAAIGGAPVAGADPQRYDGDVPGMNYDASLGAPCSSWERFIFGRGPSGQAEACHFPPPNQFPPAETGYWVISYPLYGVQQVGAPCPKPQAAAQSPDGLPMLCLGARGWQPGWFTGAGFFPPEP