drrC Family assigned · medium auto-curated
H37Rv Rv2938 · MTBC0 mtbc0_003121 ·
276 aa · 3295069–3295899 (+) ·
RefSeq NP_217454.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | daunorubicin ABC transporter permease DrrC |
|---|---|
| MTBC0 PGAP re-annotation | ABC transporter permease |
| Revised (this work) | ABC transporter permease. Pfam: ABC2_membrane (PF01061.30), ABC2_membrane_3 (PF12698.14). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WG21
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Probable doxorubicin resistance ABC transporter permease protein DrrC |
| Curated function | Probably part of the ABC transporter complex DrrABC involved in doxorubicin resistance. Probably responsible for the translocation of the substrate across the membrane. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
V Defense mechanisms
|
|---|---|
| Preferred name | drrC |
| eggNOG description | Transport permease protein |
| Orthologous group | COG0842 |
| KEGG orthology |
K01992
|
| KEGG modules |
M00254
|
| Gene Ontology (27) |
GO:0005575, GO:0005576, GO:0005618, GO:0005623, GO:0008150, GO:0009605, GO:0009607, GO:0030312, GO:0040007, GO:0043207, GO:0044110, GO:0044116 +15 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.184 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 4 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
ABC2_membrane | PF01061.30 | 1.4e-11 | 31–237 | ABC-2 type transporter |
ABC2_membrane_3 | PF12698.14 | 4.0e-08 | 80–262 | ABC-2 family transporter protein |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: drrA (daunorubicin ABC transporter ATP-binding protein DrrA), high confidence from genomic context alone (score 996 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2936 drrA |
daunorubicin ABC transporter ATP-binding protein DrrA | 999 | 996 ctx | neighborhood:836 cooccurence:764 coexpression:913 textmining:807 |
Rv2937 drrB |
daunorubicin ABC transporter permease DrrB | 994 | 989 ctx | neighborhood:836 coexpression:860 textmining:550 |
Rv2935 ppsE |
phthiocerol synthesis polyketide synthase type I PpsE | 982 | 974 ctx | neighborhood:823 coexpression:860 |
Rv2933 ppsC |
phthiocerol synthesis polyketide synthase type I PpsC | 973 | 964 ctx | neighborhood:824 coexpression:806 |
Rv2934 ppsD |
phthiocerol synthesis polyketide synthase type I PpsD | 964 | 959 ctx | neighborhood:787 coexpression:815 |
Rv2939 papA5 |
phthiocerol/phthiodiolone dimycocerosyl transferase | 973 | 958 ctx | neighborhood:689 coexpression:839 |
Rv2931 ppsA |
phthiocerol synthesis polyketide synthase type I PpsA | 877 | 816 ctx | neighborhood:765 |
Rv2932 ppsB |
phthiocerol synthesis polyketide synthase type I PpsB | 826 | 794 ctx | neighborhood:765 |
Rv2930 fadD26 |
fatty-acid--CoA ligase FadD26 | 841 | 776 ctx | neighborhood:765 |
Rv1218c |
tetronasin ABC transporter ATP-binding protein | 801 | 691 ctx | cooccurence:473 coexpression:405 |
Rv2945c lppX |
lipoprotein LppX | 775 | 651 | coexpression:651 |
Rv0180c |
transmembrane protein | 562 | 563 ctx | cooccurence:477 |
Rv1687c |
ABC transporter ATP-binding protein | 662 | 551 | coexpression:407 |
Rv1458c |
antibiotic ABC transporter ATP-binding protein | 652 | 538 | coexpression:405 |
Rv1217c |
tetronasin ABC transporter integral membrane protein | 600 | 515 ctx | cooccurence:499 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: daunorubicin ABC transporter permease DrrC
- MTBC0 PGAP product: ABC transporter permease
- Pfam (hmmscan --cut_ga): ABC2_membrane PF01061.30 (E=1e-11), ABC2_membrane_3 PF12698.14 (E=4e-08)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217454.1)
- Domains: Pfam-A via hmmscan --cut_ga — ABC2_membrane (PF01061.30), ABC2_membrane_3 (PF12698.14)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0842 - Curated reference: UniProt P9WG21 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
47 functional partner(s); context anchor
drrA - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003121|Rv2938|drrC MITTTSQEIELAPTRLPGSQNAARLFVAQTLLQTNRLLTRWARDYITVIGAIVLPILFMVVLNIVLGNLAYVVTHDSGLYSIVPLIALGAAITGSTFVAIDLMRERSFGLLARLWVLPVHRASGLISRILANAIRTLVTTLVMLGTGVVLGFRFRQGLIPSLMWISVPVILGIAIAAMVTTVALYTAQTVVVEGVELVQAIAIFFSTGLVPLNSYPGWIQPFVAHQPVSYAIAAMRGFAMGGPVLSPMIGMLVWTAGICVVCAVPLAIGYRRASTH