drrC Family assigned · medium auto-curated

H37Rv Rv2938 · MTBC0 mtbc0_003121 · 276 aa · 3295069–3295899 (+) · RefSeq NP_217454.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)daunorubicin ABC transporter permease DrrC
MTBC0 PGAP re-annotationABC transporter permease
Revised (this work)ABC transporter permease. Pfam: ABC2_membrane (PF01061.30), ABC2_membrane_3 (PF12698.14).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WG21 SwissProt · reviewed · Evidence at protein level
UniProt nameProbable doxorubicin resistance ABC transporter permease protein DrrC
Curated functionProbably part of the ABC transporter complex DrrABC involved in doxorubicin resistance. Probably responsible for the translocation of the substrate across the membrane.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category V Defense mechanisms
Preferred namedrrC
eggNOG descriptionTransport permease protein
Orthologous groupCOG0842
KEGG orthology K01992
KEGG modules M00254
Gene Ontology (27) GO:0005575, GO:0005576, GO:0005618, GO:0005623, GO:0008150, GO:0009605, GO:0009607, GO:0030312, GO:0040007, GO:0043207, GO:0044110, GO:0044116 +15 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.184 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
ABC2_membranePF01061.30 1.4e-1131–237 ABC-2 type transporter
ABC2_membrane_3PF12698.14 4.0e-0880–262 ABC-2 family transporter protein

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: drrA (daunorubicin ABC transporter ATP-binding protein DrrA), high confidence from genomic context alone (score 996 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2936 drrA daunorubicin ABC transporter ATP-binding protein DrrA 999 996 ctx neighborhood:836 cooccurence:764 coexpression:913 textmining:807
Rv2937 drrB daunorubicin ABC transporter permease DrrB 994 989 ctx neighborhood:836 coexpression:860 textmining:550
Rv2935 ppsE phthiocerol synthesis polyketide synthase type I PpsE 982 974 ctx neighborhood:823 coexpression:860
Rv2933 ppsC phthiocerol synthesis polyketide synthase type I PpsC 973 964 ctx neighborhood:824 coexpression:806
Rv2934 ppsD phthiocerol synthesis polyketide synthase type I PpsD 964 959 ctx neighborhood:787 coexpression:815
Rv2939 papA5 phthiocerol/phthiodiolone dimycocerosyl transferase 973 958 ctx neighborhood:689 coexpression:839
Rv2931 ppsA phthiocerol synthesis polyketide synthase type I PpsA 877 816 ctx neighborhood:765
Rv2932 ppsB phthiocerol synthesis polyketide synthase type I PpsB 826 794 ctx neighborhood:765
Rv2930 fadD26 fatty-acid--CoA ligase FadD26 841 776 ctx neighborhood:765
Rv1218c tetronasin ABC transporter ATP-binding protein 801 691 ctx cooccurence:473 coexpression:405
Rv2945c lppX lipoprotein LppX 775 651 coexpression:651
Rv0180c transmembrane protein 562 563 ctx cooccurence:477
Rv1687c ABC transporter ATP-binding protein 662 551 coexpression:407
Rv1458c antibiotic ABC transporter ATP-binding protein 652 538 coexpression:405
Rv1217c tetronasin ABC transporter integral membrane protein 600 515 ctx cooccurence:499

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: daunorubicin ABC transporter permease DrrC
  • MTBC0 PGAP product: ABC transporter permease
  • Pfam (hmmscan --cut_ga): ABC2_membrane PF01061.30 (E=1e-11), ABC2_membrane_3 PF12698.14 (E=4e-08)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217454.1)
  • Domains: Pfam-A via hmmscan --cut_ga — ABC2_membrane (PF01061.30), ABC2_membrane_3 (PF12698.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0842
  • Curated reference: UniProt P9WG21 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 47 functional partner(s); context anchor drrA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003121|Rv2938|drrC
MITTTSQEIELAPTRLPGSQNAARLFVAQTLLQTNRLLTRWARDYITVIGAIVLPILFMVVLNIVLGNLAYVVTHDSGLYSIVPLIALGAAITGSTFVAIDLMRERSFGLLARLWVLPVHRASGLISRILANAIRTLVTTLVMLGTGVVLGFRFRQGLIPSLMWISVPVILGIAIAAMVTTVALYTAQTVVVEGVELVQAIAIFFSTGLVPLNSYPGWIQPFVAHQPVSYAIAAMRGFAMGGPVLSPMIGMLVWTAGICVVCAVPLAIGYRRASTH