atpE Family assigned · medium auto-curated

H37Rv Rv1305 · MTBC0 mtbc0_001397 · 81 aa · 1470084–1470329 (+) · RefSeq NP_215821.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ATP synthase subunit C
MTBC0 PGAP re-annotationF0F1 ATP synthase subunit C
Revised (this work)F0F1 ATP synthase subunit C. Pfam: ATP-synt_C (PF00137.27).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WPS1 SwissProt · reviewed · Evidence at protein level
UniProt nameATP synthase subunit c
Curated functionF(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation..; FUNCTION: Key component of the F(0) channel; it plays a direct role in translocation across the membrane. A homomeric c-ring of between 10-14 s.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category C Energy production and conversion
Preferred nameatpE
eggNOG descriptionF(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation
Orthologous groupCOG0636
KEGG orthology K02110
KEGG pathways map00190, map00195, map01100
KEGG modules M00157
Gene Ontology (123) GO:0003674, GO:0003824, GO:0005215, GO:0005575, GO:0005622, GO:0005623, GO:0006139, GO:0006163, GO:0006164, GO:0006725, GO:0006753, GO:0006754 +111 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
ATP-synt_CPF00137.27 9.9e-1211–73 ATP synthase subunit C

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: atpB (ATP synthase subunit A), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1304 atpB ATP synthase subunit A 999 1000 ctx neighborhood:813 cooccurence:582 coexpression:957 experimental:997 database:984 textmining:754
Rv1307 atpH ATP synthase subunit b/delta 999 1000 ctx neighborhood:836 coexpression:999 experimental:999 database:976 textmining:749
Rv1311 atpC ATP synthase subunit epsilon 999 1000 ctx neighborhood:738 cooccurence:436 coexpression:958 experimental:997 database:970 textmining:569
Rv1306 atpF ATP synthase subunit B 999 1000 ctx neighborhood:836 coexpression:960 experimental:997 database:900 textmining:648
Rv1310 atpD ATP synthase subunit beta 999 1000 ctx neighborhood:613 coexpression:968 experimental:928 database:975 textmining:567
Rv1308 atpA ATP synthase subunit alpha 999 1000 ctx neighborhood:783 coexpression:923 experimental:928 database:982 textmining:870
Rv1309 atpG ATP synthase subunit gamma 999 1000 ctx neighborhood:783 coexpression:958 experimental:997 database:963 textmining:626
Rv1507c hyp hypothetical protein 985 983 coexpression:730 experimental:829 database:643
Rv1303 hyp hypothetical protein 965 958 ctx neighborhood:813 cooccurence:667
Rv3628 ppa inorganic pyrophosphatase 953 940 coexpression:417 database:900
Rv3921c yidC membrane protein insertase YidC 898 868 experimental:828
Rv2196 qcrB ubiquinol-cytochrome C reductase cytochrome subunit B 954 862 coexpression:862 textmining:683
Rv1300 hemK release factor glutamine methyltransferase 856 857 ctx neighborhood:651 experimental:474
Rv2195 qcrA ubiquinol-cytochrome C reductase rieske iron-sulfur subunit 880 822 coexpression:822
Rv0719 rplF 50S ribosomal protein L6 832 821 coexpression:794

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ATP synthase subunit C
  • MTBC0 PGAP product: F0F1 ATP synthase subunit C
  • Pfam (hmmscan --cut_ga): ATP-synt_C PF00137.27 (E=1e-11)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215821.1)
  • Domains: Pfam-A via hmmscan --cut_ga — ATP-synt_C (PF00137.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0636
  • Curated reference: UniProt P9WPS1 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 233 functional partner(s); context anchor atpB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001397|Rv1305|atpE
MDPTIAAGALIGGGLIMAGGAIGAGIGDGVAGNALISGVARQPEAQGRLFTPFFITVGLVEAAYFINLAFMALFVFATPVK