atpE Family assigned · medium auto-curated
H37Rv Rv1305 · MTBC0 mtbc0_001397 ·
81 aa · 1470084–1470329 (+) ·
RefSeq NP_215821.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | ATP synthase subunit C |
|---|---|
| MTBC0 PGAP re-annotation | F0F1 ATP synthase subunit C |
| Revised (this work) | F0F1 ATP synthase subunit C. Pfam: ATP-synt_C (PF00137.27). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WPS1
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | ATP synthase subunit c |
| Curated function | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation..; FUNCTION: Key component of the F(0) channel; it plays a direct role in translocation across the membrane. A homomeric c-ring of between 10-14 s. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
C Energy production and conversion
|
|---|---|
| Preferred name | atpE |
| eggNOG description | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation |
| Orthologous group | COG0636 |
| KEGG orthology |
K02110
|
| KEGG pathways |
map00190, map00195, map01100
|
| KEGG modules |
M00157
|
| Gene Ontology (123) |
GO:0003674, GO:0003824, GO:0005215, GO:0005575, GO:0005622, GO:0005623, GO:0006139, GO:0006163, GO:0006164, GO:0006725, GO:0006753, GO:0006754 +111 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.0 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 0 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
ATP-synt_C | PF00137.27 | 9.9e-12 | 11–73 | ATP synthase subunit C |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: atpB (ATP synthase subunit A), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1304 atpB |
ATP synthase subunit A | 999 | 1000 ctx | neighborhood:813 cooccurence:582 coexpression:957 experimental:997 database:984 textmining:754 |
Rv1307 atpH |
ATP synthase subunit b/delta | 999 | 1000 ctx | neighborhood:836 coexpression:999 experimental:999 database:976 textmining:749 |
Rv1311 atpC |
ATP synthase subunit epsilon | 999 | 1000 ctx | neighborhood:738 cooccurence:436 coexpression:958 experimental:997 database:970 textmining:569 |
Rv1306 atpF |
ATP synthase subunit B | 999 | 1000 ctx | neighborhood:836 coexpression:960 experimental:997 database:900 textmining:648 |
Rv1310 atpD |
ATP synthase subunit beta | 999 | 1000 ctx | neighborhood:613 coexpression:968 experimental:928 database:975 textmining:567 |
Rv1308 atpA |
ATP synthase subunit alpha | 999 | 1000 ctx | neighborhood:783 coexpression:923 experimental:928 database:982 textmining:870 |
Rv1309 atpG |
ATP synthase subunit gamma | 999 | 1000 ctx | neighborhood:783 coexpression:958 experimental:997 database:963 textmining:626 |
Rv1507c hyp |
hypothetical protein | 985 | 983 | coexpression:730 experimental:829 database:643 |
Rv1303 hyp |
hypothetical protein | 965 | 958 ctx | neighborhood:813 cooccurence:667 |
Rv3628 ppa |
inorganic pyrophosphatase | 953 | 940 | coexpression:417 database:900 |
Rv3921c yidC |
membrane protein insertase YidC | 898 | 868 | experimental:828 |
Rv2196 qcrB |
ubiquinol-cytochrome C reductase cytochrome subunit B | 954 | 862 | coexpression:862 textmining:683 |
Rv1300 hemK |
release factor glutamine methyltransferase | 856 | 857 ctx | neighborhood:651 experimental:474 |
Rv2195 qcrA |
ubiquinol-cytochrome C reductase rieske iron-sulfur subunit | 880 | 822 | coexpression:822 |
Rv0719 rplF |
50S ribosomal protein L6 | 832 | 821 | coexpression:794 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: ATP synthase subunit C
- MTBC0 PGAP product: F0F1 ATP synthase subunit C
- Pfam (hmmscan --cut_ga): ATP-synt_C PF00137.27 (E=1e-11)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215821.1)
- Domains: Pfam-A via hmmscan --cut_ga — ATP-synt_C (PF00137.27)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0636 - Curated reference: UniProt P9WPS1 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
233 functional partner(s); context anchor
atpB - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001397|Rv1305|atpE MDPTIAAGALIGGGLIMAGGAIGAGIGDGVAGNALISGVARQPEAQGRLFTPFFITVGLVEAAYFINLAFMALFVFATPVK