drrB Family assigned · medium auto-curated

H37Rv Rv2937 · MTBC0 mtbc0_003120 · 289 aa · 3294203–3295072 (+) · RefSeq NP_217453.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)daunorubicin ABC transporter permease DrrB
MTBC0 PGAP re-annotationdaunorubicin ABC transporter permease DrrB
Revised (this work)Daunorubicin ABC transporter permease DrrB. Pfam: ABC2_membrane_3 (PF12698.14).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WG23 SwissProt · reviewed · Evidence at protein level
UniProt nameDoxorubicin resistance ABC transporter permease protein DrrB
Curated functionPart of the ABC transporter complex DrrABC involved in doxorubicin resistance. Probably responsible for the translocation of the substrate across the membrane.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category V Defense mechanisms
Preferred namedrrB
eggNOG descriptionTransporter
Orthologous groupCOG0842
KEGG orthology K01992
KEGG modules M00254
Gene Ontology (31) GO:0005575, GO:0005623, GO:0005886, GO:0006629, GO:0006810, GO:0008150, GO:0008152, GO:0008610, GO:0009058, GO:0009273, GO:0009987, GO:0016020 +19 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.089 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
ABC2_membrane_3PF12698.14 1.0e-0781–278 ABC-2 family transporter protein

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: drrA (daunorubicin ABC transporter ATP-binding protein DrrA), high confidence from genomic context alone (score 997 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2936 drrA daunorubicin ABC transporter ATP-binding protein DrrA 999 997 ctx neighborhood:881 cooccurence:728 coexpression:913 textmining:948
Rv2938 drrC daunorubicin ABC transporter permease DrrC 994 989 ctx neighborhood:836 coexpression:860 textmining:550
Rv2935 ppsE phthiocerol synthesis polyketide synthase type I PpsE 989 982 ctx neighborhood:874 coexpression:860 textmining:458
Rv2933 ppsC phthiocerol synthesis polyketide synthase type I PpsC 985 978 ctx neighborhood:874 coexpression:831
Rv2939 papA5 phthiocerol/phthiodiolone dimycocerosyl transferase 982 968 ctx neighborhood:674 coexpression:855 textmining:465
Rv2934 ppsD phthiocerol synthesis polyketide synthase type I PpsD 965 958 ctx neighborhood:787 coexpression:810
Rv2931 ppsA phthiocerol synthesis polyketide synthase type I PpsA 862 815 ctx neighborhood:786
Rv2932 ppsB phthiocerol synthesis polyketide synthase type I PpsB 840 798 ctx neighborhood:786
Rv2930 fadD26 fatty-acid--CoA ligase FadD26 844 778 ctx neighborhood:770
Rv0180c transmembrane protein 618 618 ctx cooccurence:543
Rv1218c tetronasin ABC transporter ATP-binding protein 819 575 coexpression:405 textmining:593
Rv1371 membrane protein 561 561 ctx cooccurence:555
Rv1167c transcriptional regulator 550 550 ctx cooccurence:540
Rv2560 hyp hypothetical protein 512 512 ctx cooccurence:512
Rv1687c ABC transporter ATP-binding protein 649 510 coexpression:407

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: daunorubicin ABC transporter permease DrrB
  • MTBC0 PGAP product: daunorubicin ABC transporter permease DrrB
  • Pfam (hmmscan --cut_ga): ABC2_membrane_3 PF12698.14 (E=1e-07)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217453.1)
  • Domains: Pfam-A via hmmscan --cut_ga — ABC2_membrane_3 (PF12698.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0842
  • Curated reference: UniProt P9WG23 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 49 functional partner(s); context anchor drrA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003120|Rv2937|drrB
MSGPAIDASPALTFNQSSASIQQRRLSTGRQMWVLYRRFAAPSLLNGEVLTTVGAPIIFMVGFYIPFAIPWNQFVGGASSGVASNLGQYITPLVTLQAVSFAAIGSGFRAATDSLLGVNRRFQSMPMAPLTPLLARVWVAVDRCFTGLVISLVCGYVIGFRFHRGALYIVGFCLLVIAIGAVLSFAADLVGTVTRNPDAMLPLLSLPILIFGLLSIGLMPLKLFPHWIHPFVRNQPISQFVAALRALAGDTTKTASQVSWPVMAPTLTWLFAFVVILALSSTIVLARRP