drrB Family assigned · medium auto-curated
H37Rv Rv2937 · MTBC0 mtbc0_003120 ·
289 aa · 3294203–3295072 (+) ·
RefSeq NP_217453.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | daunorubicin ABC transporter permease DrrB |
|---|---|
| MTBC0 PGAP re-annotation | daunorubicin ABC transporter permease DrrB |
| Revised (this work) | Daunorubicin ABC transporter permease DrrB. Pfam: ABC2_membrane_3 (PF12698.14). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WG23
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Doxorubicin resistance ABC transporter permease protein DrrB |
| Curated function | Part of the ABC transporter complex DrrABC involved in doxorubicin resistance. Probably responsible for the translocation of the substrate across the membrane. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
V Defense mechanisms
|
|---|---|
| Preferred name | drrB |
| eggNOG description | Transporter |
| Orthologous group | COG0842 |
| KEGG orthology |
K01992
|
| KEGG modules |
M00254
|
| Gene Ontology (31) |
GO:0005575, GO:0005623, GO:0005886, GO:0006629, GO:0006810, GO:0008150, GO:0008152, GO:0008610, GO:0009058, GO:0009273, GO:0009987, GO:0016020 +19 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.089 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 4 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
ABC2_membrane_3 | PF12698.14 | 1.0e-07 | 81–278 | ABC-2 family transporter protein |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: drrA (daunorubicin ABC transporter ATP-binding protein DrrA), high confidence from genomic context alone (score 997 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2936 drrA |
daunorubicin ABC transporter ATP-binding protein DrrA | 999 | 997 ctx | neighborhood:881 cooccurence:728 coexpression:913 textmining:948 |
Rv2938 drrC |
daunorubicin ABC transporter permease DrrC | 994 | 989 ctx | neighborhood:836 coexpression:860 textmining:550 |
Rv2935 ppsE |
phthiocerol synthesis polyketide synthase type I PpsE | 989 | 982 ctx | neighborhood:874 coexpression:860 textmining:458 |
Rv2933 ppsC |
phthiocerol synthesis polyketide synthase type I PpsC | 985 | 978 ctx | neighborhood:874 coexpression:831 |
Rv2939 papA5 |
phthiocerol/phthiodiolone dimycocerosyl transferase | 982 | 968 ctx | neighborhood:674 coexpression:855 textmining:465 |
Rv2934 ppsD |
phthiocerol synthesis polyketide synthase type I PpsD | 965 | 958 ctx | neighborhood:787 coexpression:810 |
Rv2931 ppsA |
phthiocerol synthesis polyketide synthase type I PpsA | 862 | 815 ctx | neighborhood:786 |
Rv2932 ppsB |
phthiocerol synthesis polyketide synthase type I PpsB | 840 | 798 ctx | neighborhood:786 |
Rv2930 fadD26 |
fatty-acid--CoA ligase FadD26 | 844 | 778 ctx | neighborhood:770 |
Rv0180c |
transmembrane protein | 618 | 618 ctx | cooccurence:543 |
Rv1218c |
tetronasin ABC transporter ATP-binding protein | 819 | 575 | coexpression:405 textmining:593 |
Rv1371 |
membrane protein | 561 | 561 ctx | cooccurence:555 |
Rv1167c |
transcriptional regulator | 550 | 550 ctx | cooccurence:540 |
Rv2560 hyp |
hypothetical protein | 512 | 512 ctx | cooccurence:512 |
Rv1687c |
ABC transporter ATP-binding protein | 649 | 510 | coexpression:407 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: daunorubicin ABC transporter permease DrrB
- MTBC0 PGAP product: daunorubicin ABC transporter permease DrrB
- Pfam (hmmscan --cut_ga): ABC2_membrane_3 PF12698.14 (E=1e-07)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217453.1)
- Domains: Pfam-A via hmmscan --cut_ga — ABC2_membrane_3 (PF12698.14)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0842 - Curated reference: UniProt P9WG23 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
49 functional partner(s); context anchor
drrA - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003120|Rv2937|drrB MSGPAIDASPALTFNQSSASIQQRRLSTGRQMWVLYRRFAAPSLLNGEVLTTVGAPIIFMVGFYIPFAIPWNQFVGGASSGVASNLGQYITPLVTLQAVSFAAIGSGFRAATDSLLGVNRRFQSMPMAPLTPLLARVWVAVDRCFTGLVISLVCGYVIGFRFHRGALYIVGFCLLVIAIGAVLSFAADLVGTVTRNPDAMLPLLSLPILIFGLLSIGLMPLKLFPHWIHPFVRNQPISQFVAALRALAGDTTKTASQVSWPVMAPTLTWLFAFVVILALSSTIVLARRP