Rv0653c Family assigned · medium auto-curated

H37Rv Rv0653c · MTBC0 mtbc0_000691 · 231 aa · 753320–754015 (-) · RefSeq NP_215167.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transcriptional regulator
MTBC0 PGAP re-annotationTetR/AcrR family transcriptional regulator
Revised (this work)TetR/AcrR family transcriptional regulator. Pfam: TetR_N (PF00440.30), TetR_C_33 (PF13305.12).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P96941 TrEMBL · unreviewed · Evidence at protein level
UniProt namePossible transcriptional regulatory protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
eggNOG descriptionTranscriptional regulator
Orthologous groupCOG1309

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.078 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
TetR_NPF00440.30 1.8e-1111–57 Bacterial regulatory proteins, tetR family
TetR_C_33PF13305.12 7.4e-1681–198 Tetracyclin repressor-like, C-terminal domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0654 (carotenoid cleavage oxygenase), high confidence from genomic context alone (score 785 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1167c transcriptional regulator 833 833 coexpression:810
Rv1019 transcriptional regulator 823 824 coexpression:772
Rv1985c lysG HTH-type transcriptional regulator 825 822 coexpression:800
Rv3736 AraC/XylS family transcriptional regulator 811 808 coexpression:780
Rv3167c TetR family transcriptional regulator 806 806 coexpression:806
Rv1931c transcriptional regulator 806 806 coexpression:767
Rv0452 transcriptional regulator 801 801 coexpression:761
Rv0691c mftR mycofactocin biosynthesis transcriptional regulator MftR 805 800 coexpression:800
Rv3263 DNA methylase 800 800 coexpression:800
Rv0603 hyp hypothetical protein 799 799 coexpression:799
Rv3840 transcriptional regulator 799 799 coexpression:799
Rv1359 transcriptional regulator 797 797 coexpression:797
Rv3328c sigJ ECF RNA polymerase sigma factor SigJ 791 792 coexpression:732
Rv0654 carotenoid cleavage oxygenase 785 785 ctx neighborhood:785
Rv1674c transcriptional regulator 788 780 coexpression:780

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: transcriptional regulator
  • MTBC0 PGAP product: TetR/AcrR family transcriptional regulator
  • Pfam (hmmscan --cut_ga): TetR_N PF00440.30 (E=2e-11), TetR_C_33 PF13305.12 (E=7e-16)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215167.1)
  • Domains: Pfam-A via hmmscan --cut_ga — TetR_N (PF00440.30), TetR_C_33 (PF13305.12)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1309
  • Curated reference: UniProt P96941 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 46 functional partner(s); context anchor Rv0654
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000691|Rv0653c|
MTSQTGVRDELLHAGVRLLDDHGPDALQTRKVAAAAGTSTMAVYTHFGGMRGLIAAIAEEGLRQFDVALTVPQTADPVADLLAIGTAYRRYAIERPHMYRLMFGSTSAHGINVPARDVLTLKVAEIEHQHPSFAHVVRAVHRCLLAGRFATALGADDDTAIVATAAQFWSQIHGFVMLELAGFYGDRGAAVEPVLAAMTVNLLVALGDSPERAQCSLRAEQTQKNTLGRAT