mazE2 Family assigned · medium auto-curated
H37Rv Rv0660c · MTBC0 mtbc0_000698 ·
81 aa · 759066–759311 (-) ·
RefSeq NP_215174.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | antitoxin MazE2 |
|---|---|
| MTBC0 PGAP re-annotation | ribbon-helix-helix protein%2C CopG family |
| Revised (this work) | Ribbon-helix-helix protein%2C CopG family. Pfam: RHH_1 (PF01402.28). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O06779
SwissProt · reviewed
· Inferred from homology
|
|---|---|
| UniProt name | Probable antitoxin MazE2 |
| Curated function | Antitoxin component of a type II toxin-antitoxin (TA) system. |
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
RHH_1 | PF01402.28 | 5.9e-05 | 2–38 | Ribbon-helix-helix protein, copG family |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: mazF2 (toxin MazF2), high confidence from genomic context alone (score 903 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0659c mazF2 |
toxin MazF2 | 903 | 903 ctx | neighborhood:881 |
Rv0662c vapB7 |
antitoxin VapB7 | 562 | 562 ctx | neighborhood:560 |
Rv0661c vapC7 |
ribonuclease VapC7 | 561 | 561 ctx | neighborhood:560 |
Rv0658c |
integral membrane protein | 420 | 420 ctx | neighborhood:416 |
Rv1991c mazF6 |
mRNA interferase MazF6 | 661 | 72 | textmining:650 |
Rv1103c mazE3 |
antitoxin MazE3 | 870 | 46 | textmining:870 |
Rv1494 mazE4 |
antitoxin MazE4 | 414 | 46 | textmining:411 |
Rv2274A mazE8 |
antitoxin MazE8 | 870 | 41 | textmining:870 |
Rv0456B mazE1 |
antitoxin MazE1 | 870 | 41 | textmining:870 |
Rv1991A mazE6 |
antitoxin MazE6 | 803 | 41 | textmining:803 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: antitoxin MazE2
- MTBC0 PGAP product: ribbon-helix-helix protein%2C CopG family
- Pfam (hmmscan --cut_ga): RHH_1 PF01402.28 (E=6e-05)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215174.1)
- Domains: Pfam-A via hmmscan --cut_ga — RHH_1 (PF01402.28)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Curated reference: UniProt O06779 (SwissProt, reviewed; Inferred from homology)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
10 functional partner(s); context anchor
mazF2 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000698|Rv0660c|mazE2 MLSFRADDHDVDLADAWARRLHIGRSELLRDALRRHLAALAADQDVQAYTERPLTDDENALAEIADWGPAEDWADWADAAR