mazE2 Family assigned · medium auto-curated

H37Rv Rv0660c · MTBC0 mtbc0_000698 · 81 aa · 759066–759311 (-) · RefSeq NP_215174.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)antitoxin MazE2
MTBC0 PGAP re-annotationribbon-helix-helix protein%2C CopG family
Revised (this work)Ribbon-helix-helix protein%2C CopG family. Pfam: RHH_1 (PF01402.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O06779 SwissProt · reviewed · Inferred from homology
UniProt nameProbable antitoxin MazE2
Curated functionAntitoxin component of a type II toxin-antitoxin (TA) system.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
RHH_1PF01402.28 5.9e-052–38 Ribbon-helix-helix protein, copG family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: mazF2 (toxin MazF2), high confidence from genomic context alone (score 903 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0659c mazF2 toxin MazF2 903 903 ctx neighborhood:881
Rv0662c vapB7 antitoxin VapB7 562 562 ctx neighborhood:560
Rv0661c vapC7 ribonuclease VapC7 561 561 ctx neighborhood:560
Rv0658c integral membrane protein 420 420 ctx neighborhood:416
Rv1991c mazF6 mRNA interferase MazF6 661 72 textmining:650
Rv1103c mazE3 antitoxin MazE3 870 46 textmining:870
Rv1494 mazE4 antitoxin MazE4 414 46 textmining:411
Rv2274A mazE8 antitoxin MazE8 870 41 textmining:870
Rv0456B mazE1 antitoxin MazE1 870 41 textmining:870
Rv1991A mazE6 antitoxin MazE6 803 41 textmining:803

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: antitoxin MazE2
  • MTBC0 PGAP product: ribbon-helix-helix protein%2C CopG family
  • Pfam (hmmscan --cut_ga): RHH_1 PF01402.28 (E=6e-05)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215174.1)
  • Domains: Pfam-A via hmmscan --cut_ga — RHH_1 (PF01402.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Curated reference: UniProt O06779 (SwissProt, reviewed; Inferred from homology)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 10 functional partner(s); context anchor mazF2
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000698|Rv0660c|mazE2
MLSFRADDHDVDLADAWARRLHIGRSELLRDALRRHLAALAADQDVQAYTERPLTDDENALAEIADWGPAEDWADWADAAR