Rv0666 Still unknown · low auto-curated
H37Rv Rv0666 · MTBC0 mtbc0_000704 ·
57 aa · 763222–763395 (+) ·
RefSeq NP_215180.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | membrane protein |
|---|---|
| MTBC0 PGAP re-annotation | hypothetical protein |
| Revised (this work) | Conserved hypothetical protein; no recognised domain. Function unknown. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O06773
TrEMBL · unreviewed
· Predicted
|
|---|---|
| UniProt name | Possible membrane protein |
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: vapC8 (ribonuclease VapC8), high confidence from genomic context alone (score 790 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0665 vapC8 |
ribonuclease VapC8 | 790 | 790 ctx | neighborhood:781 |
Rv0664 vapB8 |
antitoxin VapB8 | 787 | 788 ctx | neighborhood:781 |
Rv0663 atsD |
arylsulfatase AtsD | 671 | 672 ctx | neighborhood:668 |
Rv0661c vapC7 |
ribonuclease VapC7 | 478 | 478 ctx | neighborhood:473 |
Rv0662c vapB7 |
antitoxin VapB7 | 474 | 475 ctx | neighborhood:473 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: membrane protein
- MTBC0 PGAP product: hypothetical protein
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215180.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Curated reference: UniProt O06773 (TrEMBL, unreviewed; Predicted)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
5 functional partner(s); context anchor
vapC8 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000704|Rv0666| MTPRTDEGAAAPCLMPDVTMPVKRGDARGALGVGPALFVVSVSSSLVRARSCRCTAD