Rv0666 Still unknown · low auto-curated

H37Rv Rv0666 · MTBC0 mtbc0_000704 · 57 aa · 763222–763395 (+) · RefSeq NP_215180.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)membrane protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Conserved hypothetical protein; no recognised domain. Function unknown.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O06773 TrEMBL · unreviewed · Predicted
UniProt namePossible membrane protein

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: vapC8 (ribonuclease VapC8), high confidence from genomic context alone (score 790 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0665 vapC8 ribonuclease VapC8 790 790 ctx neighborhood:781
Rv0664 vapB8 antitoxin VapB8 787 788 ctx neighborhood:781
Rv0663 atsD arylsulfatase AtsD 671 672 ctx neighborhood:668
Rv0661c vapC7 ribonuclease VapC7 478 478 ctx neighborhood:473
Rv0662c vapB7 antitoxin VapB7 474 475 ctx neighborhood:473

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: membrane protein
  • MTBC0 PGAP product: hypothetical protein
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215180.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Curated reference: UniProt O06773 (TrEMBL, unreviewed; Predicted)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 5 functional partner(s); context anchor vapC8
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000704|Rv0666|
MTPRTDEGAAAPCLMPDVTMPVKRGDARGALGVGPALFVVSVSSSLVRARSCRCTAD