vapC7 Family assigned · medium auto-curated

H37Rv Rv0661c · MTBC0 mtbc0_000699 · 145 aa · 759421–759858 (-) · RefSeq NP_215175.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ribonuclease VapC7
MTBC0 PGAP re-annotationtype II toxin-antitoxin system VapC family toxin
Revised (this work)Type II toxin-antitoxin system VapC family toxin. Pfam: PIN (PF01850.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WFB3 SwissProt · reviewed · Inferred from homology
UniProt nameRibonuclease VapC7
EC (curated) EC 3.1.-.-
Curated functionToxic component of a type II toxin-antitoxin (TA) system. An RNase. The cognate antitoxin is VapB7 (By similarity).

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionToxic component of a toxin-antitoxin (TA) module. An RNase
Orthologous groupCOG1848
KEGG orthology K07064

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PINPF01850.28 2.0e-142–126 PIN domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: vapB7 (antitoxin VapB7), high confidence from genomic context alone (score 886 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0662c vapB7 antitoxin VapB7 942 886 ctx neighborhood:882 textmining:511
Rv0660c mazE2 antitoxin MazE2 561 561 ctx neighborhood:560
Rv0663 atsD arylsulfatase AtsD 542 543 ctx neighborhood:540
Rv0659c mazF2 toxin MazF2 526 525 ctx neighborhood:524
Rv0666 membrane protein 478 478 ctx neighborhood:473
Rv0665 vapC8 ribonuclease VapC8 515 475 ctx neighborhood:475
Rv0664 vapB8 antitoxin VapB8 736 474 ctx neighborhood:473 textmining:520
Rv2871 vapB43 antitoxin VapB43 798 403 textmining:677
Rv0748 vapB31 antitoxin VapB31 402 403
Rv3181c vapB49 antitoxin VapB45 457 69 textmining:441
Rv0616A vapB29 antitoxin VapB29 526 62 textmining:516
Rv0596c vapB4 antitoxin VapB4 444 61 textmining:433
Rv2760c vapB42 antitoxin VapB42 441 53 textmining:434
Rv3180c vapC49 ribonuclease VapC45 483 52 textmining:478
Rv2872 vapC43 ribonuclease VapC43 762 50 textmining:760

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ribonuclease VapC7
  • MTBC0 PGAP product: type II toxin-antitoxin system VapC family toxin
  • Pfam (hmmscan --cut_ga): PIN PF01850.28 (E=2e-14)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215175.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PIN (PF01850.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1848
  • Curated reference: UniProt P9WFB3 (SwissProt, reviewed; Inferred from homology)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 32 functional partner(s); context anchor vapB7
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000699|Rv0661c|vapC7
MIVLDTTVLVYAKGAEHPLRDPCRDLVAAIADERIAATTTAEVIQEFVHVRARRRDRSDAAALGRVTMPNCSRRYSPSIEATSKRGLTLFETTPGLEACDAVLAAVAASAGATALVSADPAFADLSDVVHVIPDAAGMVSLLGDR