vapC7 Family assigned · medium auto-curated
H37Rv Rv0661c · MTBC0 mtbc0_000699 ·
145 aa · 759421–759858 (-) ·
RefSeq NP_215175.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | ribonuclease VapC7 |
|---|---|
| MTBC0 PGAP re-annotation | type II toxin-antitoxin system VapC family toxin |
| Revised (this work) | Type II toxin-antitoxin system VapC family toxin. Pfam: PIN (PF01850.28). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WFB3
SwissProt · reviewed
· Inferred from homology
|
|---|---|
| UniProt name | Ribonuclease VapC7 |
| EC (curated) |
EC 3.1.-.-
|
| Curated function | Toxic component of a type II toxin-antitoxin (TA) system. An RNase. The cognate antitoxin is VapB7 (By similarity). |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Toxic component of a toxin-antitoxin (TA) module. An RNase |
| Orthologous group | COG1848 |
| KEGG orthology |
K07064
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
PIN | PF01850.28 | 2.0e-14 | 2–126 | PIN domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: vapB7 (antitoxin VapB7), high confidence from genomic context alone (score 886 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0662c vapB7 |
antitoxin VapB7 | 942 | 886 ctx | neighborhood:882 textmining:511 |
Rv0660c mazE2 |
antitoxin MazE2 | 561 | 561 ctx | neighborhood:560 |
Rv0663 atsD |
arylsulfatase AtsD | 542 | 543 ctx | neighborhood:540 |
Rv0659c mazF2 |
toxin MazF2 | 526 | 525 ctx | neighborhood:524 |
Rv0666 |
membrane protein | 478 | 478 ctx | neighborhood:473 |
Rv0665 vapC8 |
ribonuclease VapC8 | 515 | 475 ctx | neighborhood:475 |
Rv0664 vapB8 |
antitoxin VapB8 | 736 | 474 ctx | neighborhood:473 textmining:520 |
Rv2871 vapB43 |
antitoxin VapB43 | 798 | 403 | textmining:677 |
Rv0748 vapB31 |
antitoxin VapB31 | 402 | 403 | |
Rv3181c vapB49 |
antitoxin VapB45 | 457 | 69 | textmining:441 |
Rv0616A vapB29 |
antitoxin VapB29 | 526 | 62 | textmining:516 |
Rv0596c vapB4 |
antitoxin VapB4 | 444 | 61 | textmining:433 |
Rv2760c vapB42 |
antitoxin VapB42 | 441 | 53 | textmining:434 |
Rv3180c vapC49 |
ribonuclease VapC45 | 483 | 52 | textmining:478 |
Rv2872 vapC43 |
ribonuclease VapC43 | 762 | 50 | textmining:760 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: ribonuclease VapC7
- MTBC0 PGAP product: type II toxin-antitoxin system VapC family toxin
- Pfam (hmmscan --cut_ga): PIN PF01850.28 (E=2e-14)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215175.1)
- Domains: Pfam-A via hmmscan --cut_ga — PIN (PF01850.28)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1848 - Curated reference: UniProt P9WFB3 (SwissProt, reviewed; Inferred from homology)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
32 functional partner(s); context anchor
vapB7 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000699|Rv0661c|vapC7 MIVLDTTVLVYAKGAEHPLRDPCRDLVAAIADERIAATTTAEVIQEFVHVRARRRDRSDAAALGRVTMPNCSRRYSPSIEATSKRGLTLFETTPGLEACDAVLAAVAASAGATALVSADPAFADLSDVVHVIPDAAGMVSLLGDR