Rv0603 Family assigned · low

H37Rv Rv0603 · MTBC0 mtbc0_000633 · 103 aa · 703408–703719 (+) · RefSeq NP_215117.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Secreted protein with a solved NMR structure (PDB 2LRA, Rv0603); fold characterised, function not established.

Curated reference (UniProt)

UniProt O07775 TrEMBL · unreviewed · Evidence at protein level
UniProt namePossible exported protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2EQ52

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 2 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 1.77% of strains (2572) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 67.3 (low). Low-confidence model: the fold may be unreliable, so treat these structural hits with caution.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
2lra-assembly1_A 1.00 0.67 3.7e-09 sig 2lra-assembly1_A NMR Structure of Signal Sequence Deleted (SSD) Rv0603 Protein from Mycobacterium tuberculosis without N-terminal His-tag
7ath-assembly1_AAA 1.00 0.60 1.5e-02 7ath-assembly1_AAA Crystal structure of UipA
2gu3-assembly1_A 0.90 0.65 4.7e-01 2gu3-assembly1_A YpmB protein from Bacillus subtilis
4fr9-assembly1_A 0.72 0.50 2.2e-01 4fr9-assembly1_A Crystal structure of a BLIP-like protein (BF1215) from Bacteroides fragilis NCTC 9343 at 1.20 A resolution
5igh-assembly1_A 0.60 0.62 7.4e-01 5igh-assembly1_A Macrolide 2'-phosphotransferase type I
4fma-assembly3_C 0.14 0.50 4.5e+00 4fma-assembly3_C EspG structure
8suc-assembly1_A 0.13 0.62 4.2e+00 8suc-assembly1_A NHL-2 NHL domain
2hxc-assembly1_A 0.13 0.76 7.5e+00 2hxc-assembly1_A Crystal structure of the benzylamine complex of aromatic amine dehydrogenase in N-semiquinone form

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: tcrA (two component DNA binding transcriptional regulator TcrA), high confidence from genomic context alone (score 936 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0602c tcrA two component DNA binding transcriptional regulator TcrA 935 936 ctx neighborhood:559 coexpression:860
Rv0604 lpqO lipoprotein LpqO 879 879 ctx neighborhood:568 coexpression:731
Rv1675c cmr HTH-type transcriptional regulator Cmr 850 850 coexpression:850
Rv3167c TetR family transcriptional regulator 841 841 coexpression:841
Rv3082c virS HTH-type transcriptional regulator VirS 827 827 coexpression:827
Rv1151c cobB NAD-dependent protein deacylase 827 827 coexpression:827
Rv3840 transcriptional regulator 826 826 coexpression:826
Rv0691c mftR mycofactocin biosynthesis transcriptional regulator MftR 822 822 coexpression:822
Rv1267c embR transcriptional regulator EmbR 819 819 coexpression:819
Rv0117 oxyS oxidative stress response regulatory protein OxyS 817 817 coexpression:817
Rv1931c transcriptional regulator 817 817 coexpression:817
Rv1027c kdpE transcriptional regulator KdpE 813 813 coexpression:813
Rv0494 HTH-type transcriptional regulator 813 813 coexpression:813
Rv3830c TetR family transcriptional regulator 810 810 coexpression:810
Rv1190 hyp hypothetical protein 810 810 coexpression:810

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • MTBC0 PGAP product: hypothetical protein
  • Foldseek best: 2lra-assembly1_A NMR Structure of Signal Sequence Deleted (SSD) Rv0603 Protein f (prob 1.00, E=4e-09, TM=0.67)
  • (structure-only promotion reviewed by hand, 2026-06-01)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215117.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2EQ52
  • Curated reference: UniProt O07775 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 67.3, low)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 69 functional partner(s); context anchor tcrA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000633|Rv0603|
MNRIVQFGVSAVAAAAIGIGAGSGIAAAFDGEDEVTGPDADRARAAAVQAVPGGTAGEVETETGEGAAAYGVLVTRPDGTRVEVHLDRDFRVLDTEPADGDGG