rplL Resolved · high auto-curated

H37Rv Rv0652 · MTBC0 mtbc0_000690 · 130 aa · 752935–753327 (+) · RefSeq NP_215166.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)50S ribosomal protein L7/L12
MTBC0 PGAP re-annotation50S ribosomal protein L7/L12
Revised (this work)50S ribosomal protein L7/L12. Pfam: Ribosomal_L12_N (PF16320.11), Ribosomal_L12 (PF00542.25).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WHE3 SwissProt · reviewed · Evidence at protein level
UniProt nameLarge ribosomal subunit protein bL12
Curated functionForms part of the ribosomal stalk which helps the ribosome interact with GTP-bound translation factors. Is thus essential for accurate translation.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred namerplL
eggNOG descriptionForms part of the ribosomal stalk which helps the ribosome interact with GTP-bound translation factors. Is thus essential for accurate translation
Orthologous groupCOG0222
KEGG orthology K02935
KEGG pathways map03010
KEGG modules M00178
Gene Ontology (15) GO:0005575, GO:0005618, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005886, GO:0008150, GO:0016020, GO:0030312, GO:0040007, GO:0044424 +3 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Ribosomal_L12_NPF16320.11 3.1e-196–53 Ribosomal protein L7/L12 dimerisation domain
Ribosomal_L12PF00542.25 7.3e-2863–130 Ribosomal protein L7/L12 C-terminal domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rplJ (50S ribosomal protein L10), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0651 rplJ 50S ribosomal protein L10 999 1000 ctx neighborhood:827 cooccurence:501 coexpression:967 experimental:969 textmining:775
Rv3443c rplM 50S ribosomal protein L13 998 997 ctx cooccurence:496 coexpression:913 experimental:928 textmining:672
Rv3442c rpsI 30S ribosomal protein S9 998 997 coexpression:959 experimental:928 textmining:585
Rv0640 rplK 50S ribosomal protein L11 998 996 ctx cooccurence:568 coexpression:863 experimental:928 textmining:623
Rv0708 rplP 50S ribosomal protein L16 998 995 coexpression:875 experimental:928 textmining:662
Rv2441c rpmA 50S ribosomal protein L27 997 994 coexpression:875 experimental:928 textmining:604
Rv0721 rpsE 30S ribosomal protein S5 997 994 coexpression:917 experimental:928 textmining:591
Rv0682 rpsL 30S ribosomal protein S12 996 994 coexpression:864 experimental:927 textmining:420
Rv1643 rplT 50S ribosomal protein L20 996 994 coexpression:863 experimental:928 textmining:535
Rv0683 rpsG 30S ribosomal protein S7 995 994 coexpression:863 experimental:928
Rv2890c rpsB 30S ribosomal protein S2 997 993 coexpression:889 experimental:928 textmining:587
Rv0641 rplA 50S ribosomal protein L1 997 993 coexpression:864 experimental:913 textmining:621
Rv0702 rplD 50S ribosomal protein L4 996 993 coexpression:875 experimental:928 textmining:583
Rv3456c rplQ 50S ribosomal protein L17 995 993 coexpression:871 experimental:928
Rv0707 rpsC 30S ribosomal protein S3 996 992 coexpression:875 experimental:921 textmining:602

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: 50S ribosomal protein L7/L12
  • MTBC0 PGAP product: 50S ribosomal protein L7/L12
  • Pfam (hmmscan --cut_ga): Ribosomal_L12_N PF16320.11 (E=3e-19), Ribosomal_L12 PF00542.25 (E=7e-28)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215166.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Ribosomal_L12_N (PF16320.11), Ribosomal_L12 (PF00542.25)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0222
  • Curated reference: UniProt P9WHE3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 188 functional partner(s); context anchor rplJ
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000690|Rv0652|rplL
MAKLSTDELLDAFKEMTLLELSDFVKKFEETFEVTAAAPVAVAAAGAAPAGAAVEAAEEQSEFDVILEAAGDKKIGVIKVVREIVSGLGLKEAKDLVDGAPKPLLEKVAKEAADEAKAKLEAAGATVTVK