mmaA3 Resolved · high auto-curated

H37Rv Rv0643c · MTBC0 mtbc0_000681 · 293 aa · 740821–741702 (-) · RefSeq NP_215157.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)methoxy mycolic acid synthase MmaA3
MTBC0 PGAP re-annotationmethoxy mycolic acid synthase MmaA3
Revised (this work)Methoxy mycolic acid synthase MmaA3. Pfam: CMAS (PF02353.27), Methyltransf_23 (PF13489.13), Methyltransf_25 (PF13649.13), Methyltransf_11 (PF08241.19).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P0CH91 SwissProt · reviewed · Evidence at protein level
UniProt nameMethoxy mycolic acid synthase MmaA3
EC (curated) EC 2.1.1.-
Curated functionInvolved in the biosynthesis of methoxymycolic acid. It catalyzes the O-methylation of the hydroxy group of the hydroxymycolate to form a methyl ether.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category M Cell wall / membrane / envelope biogenesis
Preferred namemmaA3
eggNOG descriptionInvolved in the biosynthesis of methoxymycolic acid. It catalyzes the O-methylation of the hydroxy group of the hydroxymycolate to form a methyl ether
Orthologous groupCOG2230
EC number EC 2.1.1.79
KEGG orthology K00574
Gene Ontology (51) GO:0003674, GO:0003824, GO:0005575, GO:0005623, GO:0005886, GO:0006082, GO:0006629, GO:0006631, GO:0006633, GO:0008150, GO:0008152, GO:0008168 +39 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.293 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
CMASPF02353.27 2.0e-12510–289 Mycolic acid cyclopropane synthetase
Methyltransf_23PF13489.13 2.4e-0865–229 Methyltransferase domain
Methyltransf_25PF13649.13 8.5e-0875–165 Methyltransferase domain
Methyltransf_11PF08241.19 3.7e-0675–171 Methyltransferase domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: mmaA4 (hydroxymycolate synthase MmaA4), high confidence from genomic context alone (score 919 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0642c mmaA4 hydroxymycolate synthase MmaA4 920 919 ctx neighborhood:589 coexpression:806
Rv0644c mmaA2 cyclopropane mycolic acid synthase CmaA 681 677 ctx neighborhood:496
Rv0448c hyp hypothetical protein 442 419
Rv0449c hyp hypothetical protein 429 403
Rv0636 hadB (3R)-hydroxyacyl-ACP dehydratase subunit HadB 593 289 textmining:451
Rv3800c pks13 polyketide synthase 443 120
Rv2245 kasA 3-oxoacyl-ACP synthase 1 421 68 textmining:405
Rv0386 transcriptional regulator 418 57 textmining:409
Rv2488c LuxR family transcriptional regulator 417 55 textmining:409
Rv0373c carbon monoxyde dehydrogenase large subunit 411 45 textmining:409
Rv0195 two component transcriptional regulator 408 41 textmining:409

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: methoxy mycolic acid synthase MmaA3
  • MTBC0 PGAP product: methoxy mycolic acid synthase MmaA3
  • Pfam (hmmscan --cut_ga): CMAS PF02353.27 (E=2e-125), Methyltransf_23 PF13489.13 (E=2e-08), Methyltransf_25 PF13649.13 (E=8e-08), Methyltransf_11 PF08241.19 (E=4e-06)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215157.1)
  • Domains: Pfam-A via hmmscan --cut_ga — CMAS (PF02353.27), Methyltransf_23 (PF13489.13), Methyltransf_25 (PF13649.13), Methyltransf_11 (PF08241.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2230
  • Curated reference: UniProt P0CH91 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 11 functional partner(s); context anchor mmaA4
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000681|Rv0643c|mmaA3
MSDNSTGTTKSRSNVDDVQAHYDLSDAFFALFQDPTRTYSCAYFERDDMTLHEAQVAKLDLTLGKLGLEPGMTLLDVGCGWGSVMKRAVERYDVNVVGLTLSKNQHAYCQQVLDKVDTNRSHRVLLSDWANFSEPVDRIVTIEAIEHFGFERYDDFFKFAYNAMPADGVMLLHSITGLHVKQVIERGIPLTMEMAKFIRFIVTDIFPGGRLPTIETIEEHVTKAGFTITDIQSLQPHFARTLDLWAEALQAHKDEAIEIQSAEVYERYMKYLTGCAKAFRMGYIDCNQFTLAK