Rv1359 Family assigned · low auto-curated

H37Rv Rv1359 · MTBC0 - · 250 aa · 1530173–1530925 (+) · RefSeq NP_215875.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transcriptional regulator
MTBC0 PGAP re-annotation
Revised (this work)Transcriptional regulator.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WM05 SwissProt · reviewed · Predicted
UniProt nameUncharacterized protein Rv1359

UniProt still lists this protein as Uncharacterized protein Rv1359; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
eggNOG descriptionregulation of cellular process
Orthologous groupCOG2114
Gene Ontology (13) GO:0008150, GO:0010468, GO:0010565, GO:0019216, GO:0019217, GO:0019222, GO:0031323, GO:0050789, GO:0050794, GO:0060255, GO:0062012, GO:0065007 +1 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.339 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1358 (transcriptional regulator), high confidence from genomic context alone (score 904 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1358 transcriptional regulator 920 904 ctx neighborhood:551 coexpression:731
Rv1675c cmr HTH-type transcriptional regulator Cmr 898 895 coexpression:833
Rv0894 transcriptional regulator 893 894 coexpression:860
Rv3830c TetR family transcriptional regulator 890 891 coexpression:827
Rv3263 DNA methylase 876 877 coexpression:860
Rv3840 transcriptional regulator 860 860 coexpression:860
Rv3167c TetR family transcriptional regulator 860 860 coexpression:860
Rv0691c mftR mycofactocin biosynthesis transcriptional regulator MftR 860 860 coexpression:860
Rv0602c tcrA two component DNA binding transcriptional regulator TcrA 858 858 coexpression:839
Rv0212c nadR transcriptional regulator NadR 857 857 coexpression:857
Rv1931c transcriptional regulator 855 855 coexpression:855
Rv1674c transcriptional regulator 850 850 coexpression:850
Rv1776c transcriptional regulator 848 848 coexpression:815
Rv2488c LuxR family transcriptional regulator 846 847 coexpression:805
Rv3736 AraC/XylS family transcriptional regulator 846 846 coexpression:846

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): transcriptional regulator
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215875.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2114
  • Curated reference: UniProt P9WM05 (SwissProt, reviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 149 functional partner(s); context anchor Rv1358
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv1359|
MFMALRAPMLERMNGLHTDDAPVNWLERRGGRLTSRRRVTLLHAGVEHPMRLWGVQSEAITAAMVLSRKVSAIIAGHCGVRLVDQGVGDGFVAAFAHASDAVACALELHQAPLSPIVLRIGIHTGEAQLVDERIYAGATMNLAAELRDLAHGGQTVMSGATEDAVLGRLPMRAWLIGLRPMEGSPEGHNFPQSQRIAQLCHPNLRNTFPPLRMRIADASGIPYVGRILVNVQVVPHWEGGCAAAGMVLAG