Rv2989 Family assigned · medium auto-curated

H37Rv Rv2989 · MTBC0 mtbc0_003174 · 233 aa · 3367456–3368157 (+) · RefSeq NP_217505.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transcriptional regulator
MTBC0 PGAP re-annotationIclR family transcriptional regulator
Revised (this work)IclR family transcriptional regulator. Pfam: HTH_IclR (PF09339.17), IclR_C (PF01614.25).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53238 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable transcriptional regulatory protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
Preferred nameltbR
eggNOG descriptionTranscriptional regulator
Orthologous groupCOG1414

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.397 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
HTH_IclRPF09339.17 1.7e-109–54 IclR helix-turn-helix domain
IclR_CPF01614.25 3.4e-2183–229 Bacterial transcriptional regulator IclR C-terminal

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: leuC (3-isopropylmalate dehydratase large subunit), high confidence from genomic context alone (score 969 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2988c leuC 3-isopropylmalate dehydratase large subunit 983 969 ctx neighborhood:785 coexpression:860 textmining:499
Rv2987c leuD 3-isopropylmalate dehydratase small subunit 964 952 ctx neighborhood:764 coexpression:804
Rv0264c hyp hypothetical protein 667 668 coexpression:656
Rv0263c hyp hypothetical protein 657 657 coexpression:645
Rv2239c hyp hypothetical protein 614 615 ctx cooccurence:613
Rv2986c hupB DNA-binding protein HU 464 444 ctx neighborhood:440
Rv1249c membrane protein 439 439 coexpression:420
Rv2631 rtcB RNA-splicing ligase RtcB 458 52 textmining:453
Rv3600c coaX type III pantothenate kinase 577 51 textmining:573
Rv3742c oxidoreductase 440 47 textmining:437
Rv2003c hyp hypothetical protein 530 44 textmining:529
Rv2037c transmembrane protein 651 41 textmining:651
Rv3603c hyp hypothetical protein 539 41 textmining:539
Rv1291c hyp hypothetical protein 431 41 textmining:431

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: transcriptional regulator
  • MTBC0 PGAP product: IclR family transcriptional regulator
  • Pfam (hmmscan --cut_ga): HTH_IclR PF09339.17 (E=2e-10), IclR_C PF01614.25 (E=3e-21)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217505.1)
  • Domains: Pfam-A via hmmscan --cut_ga — HTH_IclR (PF09339.17), IclR_C (PF01614.25)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1414
  • Curated reference: UniProt O53238 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 14 functional partner(s); context anchor leuC
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003174|Rv2989|
MRQHSGIGVLDKAVGVLHAVAESPCGLAELCDRTDLPRATAYRLAAALEVHRLLGRGQDGHWRLGPAITELATHVDDPLLVACAAVLPQLRDATGESVQVYRREGTSRVCVAALEPAAGLRDTVPVGARLPMTAGSGAKVLLAHTDAATQAAVLPKAVFSARALAEVCRRGWAQSVAEREPGVASVSAPVRDGRGVVIAAISVSGPIDRMGRRPGVRWAADLLSAADALTRRL