sigJ Family assigned · medium auto-curated

H37Rv Rv3328c · MTBC0 mtbc0_003541 · 312 aa · 3739379–3740317 (-) · RefSeq NP_217845.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ECF RNA polymerase sigma factor SigJ
MTBC0 PGAP re-annotationsigma-70 family RNA polymerase sigma factor SigJ
Revised (this work)Sigma-70 family RNA polymerase sigma factor SigJ. Pfam: Sigma70_r2 (PF04542.21), Sigma70_r4_2 (PF08281.19), SnoaL_2 (PF12680.14).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt L0TCG5 SwissProt · reviewed · Evidence at protein level
UniProt nameECF RNA polymerase sigma factor SigJ
Curated functionSigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. Extracytoplasmic function (ECF) sigma factors are held in an inactive form by an anti-sigma factor until released, although no anti-sigma factor is known for this protein (By similarity). Regulates the promoter of SigI, may not be autoregulated.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
Preferred namesigJ
eggNOG descriptionBelongs to the sigma-70 factor family. ECF subfamily
Orthologous groupCOG1595
KEGG orthology K03088
Gene Ontology (28) GO:0000988, GO:0000990, GO:0003674, GO:0006355, GO:0008150, GO:0009889, GO:0010468, GO:0010556, GO:0016987, GO:0019219, GO:0019222, GO:0031323 +16 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.309 · purifying
Polymorphic sites (≥ 0.1% of strains) 6 synonymous, 5 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Sigma70_r2PF04542.21 3.2e-126–68 Sigma-70 region 2
Sigma70_r4_2PF08281.19 6.2e-12107–155 Sigma-70, region 4
SnoaL_2PF12680.14 5.3e-07176–280 SnoaL-like domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1931c (transcriptional regulator), high confidence from genomic context alone (score 876 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1931c transcriptional regulator 880 876 ctx cooccurence:524 coexpression:751
Rv1725c hyp hypothetical protein 858 859 coexpression:822
Rv2488c LuxR family transcriptional regulator 846 837 coexpression:804
Rv2788 sirR transcriptional repressor SirR 827 826 coexpression:822
Rv3736 AraC/XylS family transcriptional regulator 815 808 coexpression:808
Rv0377 HTH-type transcriptional regulator 815 808 coexpression:808
Rv3167c TetR family transcriptional regulator 801 802 coexpression:731
Rv3263 DNA methylase 799 799 coexpression:799
Rv2760c vapB42 antitoxin VapB42 799 799 coexpression:799
Rv1773c transcriptional regulator 804 797 coexpression:797
Rv1359 transcriptional regulator 796 796 coexpression:796
Rv3164c moxR3 methanol dehydrogenase transcriptional regulator MoxR 796 796 coexpression:796
Rv1189 sigI ECF RNA polymerase sigma factor SigI 833 793 coexpression:730
Rv0653c transcriptional regulator 791 792 coexpression:732
Rv0691c mftR mycofactocin biosynthesis transcriptional regulator MftR 793 788 coexpression:788

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ECF RNA polymerase sigma factor SigJ
  • MTBC0 PGAP product: sigma-70 family RNA polymerase sigma factor SigJ
  • Pfam (hmmscan --cut_ga): Sigma70_r2 PF04542.21 (E=3e-12), Sigma70_r4_2 PF08281.19 (E=6e-12), SnoaL_2 PF12680.14 (E=5e-07)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217845.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Sigma70_r2 (PF04542.21), Sigma70_r4_2 (PF08281.19), SnoaL_2 (PF12680.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1595
  • Curated reference: UniProt L0TCG5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 84 functional partner(s); context anchor Rv1931c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003541|Rv3328c|sigJ
MEVSEFEALRQHLMSVAYRLTGTVADAEDIVQEAWLRWDSQDTVIADPRAWLTTVVSRLGLDKLRSAAHRRETYTGTWLPEPVVTGLDATDPLAAVVAAEDARFAAMVVLERLRPDQRVAFVLHDGFAVPFAEVAEVLGTSEAAARQLASRARKAVTAQPALISGDPDPAHNEVVGRLMAAMAAGDLDTVVSLLHPDVTFTGDSNGKAPTAVRAVRGSDKVVRFILGLVQRYGPGLFGANQLALVNGELGAYTAGLPGVDGYRAMAPRITAITVRDGKVCALWDIANPDKFTGSPLKERRAQPTGRGRHHRN