Rv0452 Family assigned · medium auto-curated

H37Rv Rv0452 · MTBC0 mtbc0_000474 · 236 aa · 545507–546217 (+) · RefSeq NP_214966.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transcriptional regulator
MTBC0 PGAP re-annotationTetR family transcriptional regulator
Revised (this work)TetR family transcriptional regulator. Pfam: TetR_N (PF00440.30), TetR_C_34 (PF17929.8).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53737 TrEMBL · unreviewed · Evidence at protein level
UniProt namePossible transcriptional regulatory protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
eggNOG descriptionTranscriptional regulator
Orthologous groupCOG1309

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
TetR_NPF00440.30 3.1e-0528–72 Bacterial regulatory proteins, tetR family
TetR_C_34PF17929.8 2.1e-2980–225 Tetracyclin repressor-like, C-terminal domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2912c (TetR family HTH-type transcriptional regulator), high confidence from genomic context alone (score 842 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1556 HTH-type transcriptional regulator 854 854 coexpression:788
Rv2912c TetR family HTH-type transcriptional regulator 842 842 ctx cooccurence:434 coexpression:733
Rv1963c mce3R transcriptional repressor Mce3R 826 826 coexpression:826
Rv1167c transcriptional regulator 825 826 coexpression:799
Rv3830c TetR family transcriptional regulator 821 822 coexpression:797
Rv3167c TetR family transcriptional regulator 813 813 coexpression:813
Rv0212c nadR transcriptional regulator NadR 812 803 coexpression:803
Rv1151c cobB NAD-dependent protein deacylase 810 803 coexpression:803
Rv1931c transcriptional regulator 810 802 coexpression:802
Rv1267c embR transcriptional regulator EmbR 806 802 coexpression:802
Rv0653c transcriptional regulator 801 801 coexpression:761
Rv3082c virS HTH-type transcriptional regulator VirS 803 800 coexpression:800
Rv0494 HTH-type transcriptional regulator 804 799 coexpression:799
Rv0737 transcriptional regulator 783 783 coexpression:783
Rv1359 transcriptional regulator 778 778 coexpression:731

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: transcriptional regulator
  • MTBC0 PGAP product: TetR family transcriptional regulator
  • Pfam (hmmscan --cut_ga): TetR_N PF00440.30 (E=3e-05), TetR_C_34 PF17929.8 (E=2e-29)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214966.1)
  • Domains: Pfam-A via hmmscan --cut_ga — TetR_N (PF00440.30), TetR_C_34 (PF17929.8)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1309
  • Curated reference: UniProt O53737 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 79 functional partner(s); context anchor Rv2912c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000474|Rv0452|
MRYPLAVAQLGFQRARTEENKRQRAAALVEAARSLALETGVASVTLTAVAGRAGIHYSAVRRYFTSHKEVLLHLAAEGWARWSGTVCEQLGEPGPMSAPRVAEALANGLAADPLFCDLLANLHLHLEQEVDVDRVIEVKRTSIAAVIALVDAIESALPALGRSGAFDILLAAYSLAATLWQIANPPERLTDAYAEEPELLPPEWNLDFAAALTRLLTATLLGLLAGSPCECRSPTR