Rv0452 Family assigned · medium auto-curated
H37Rv Rv0452 · MTBC0 mtbc0_000474 ·
236 aa · 545507–546217 (+) ·
RefSeq NP_214966.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | transcriptional regulator |
|---|---|
| MTBC0 PGAP re-annotation | TetR family transcriptional regulator |
| Revised (this work) | TetR family transcriptional regulator. Pfam: TetR_N (PF00440.30), TetR_C_34 (PF17929.8). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O53737
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Possible transcriptional regulatory protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
K Transcription
|
|---|---|
| eggNOG description | Transcriptional regulator |
| Orthologous group | COG1309 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
TetR_N | PF00440.30 | 3.1e-05 | 28–72 | Bacterial regulatory proteins, tetR family |
TetR_C_34 | PF17929.8 | 2.1e-29 | 80–225 | Tetracyclin repressor-like, C-terminal domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv2912c (TetR family HTH-type transcriptional regulator), high confidence from genomic context alone (score 842 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1556 |
HTH-type transcriptional regulator | 854 | 854 | coexpression:788 |
Rv2912c |
TetR family HTH-type transcriptional regulator | 842 | 842 ctx | cooccurence:434 coexpression:733 |
Rv1963c mce3R |
transcriptional repressor Mce3R | 826 | 826 | coexpression:826 |
Rv1167c |
transcriptional regulator | 825 | 826 | coexpression:799 |
Rv3830c |
TetR family transcriptional regulator | 821 | 822 | coexpression:797 |
Rv3167c |
TetR family transcriptional regulator | 813 | 813 | coexpression:813 |
Rv0212c nadR |
transcriptional regulator NadR | 812 | 803 | coexpression:803 |
Rv1151c cobB |
NAD-dependent protein deacylase | 810 | 803 | coexpression:803 |
Rv1931c |
transcriptional regulator | 810 | 802 | coexpression:802 |
Rv1267c embR |
transcriptional regulator EmbR | 806 | 802 | coexpression:802 |
Rv0653c |
transcriptional regulator | 801 | 801 | coexpression:761 |
Rv3082c virS |
HTH-type transcriptional regulator VirS | 803 | 800 | coexpression:800 |
Rv0494 |
HTH-type transcriptional regulator | 804 | 799 | coexpression:799 |
Rv0737 |
transcriptional regulator | 783 | 783 | coexpression:783 |
Rv1359 |
transcriptional regulator | 778 | 778 | coexpression:731 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: transcriptional regulator
- MTBC0 PGAP product: TetR family transcriptional regulator
- Pfam (hmmscan --cut_ga): TetR_N PF00440.30 (E=3e-05), TetR_C_34 PF17929.8 (E=2e-29)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214966.1)
- Domains: Pfam-A via hmmscan --cut_ga — TetR_N (PF00440.30), TetR_C_34 (PF17929.8)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1309 - Curated reference: UniProt O53737 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
79 functional partner(s); context anchor
Rv2912c - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000474|Rv0452| MRYPLAVAQLGFQRARTEENKRQRAAALVEAARSLALETGVASVTLTAVAGRAGIHYSAVRRYFTSHKEVLLHLAAEGWARWSGTVCEQLGEPGPMSAPRVAEALANGLAADPLFCDLLANLHLHLEQEVDVDRVIEVKRTSIAAVIALVDAIESALPALGRSGAFDILLAAYSLAATLWQIANPPERLTDAYAEEPELLPPEWNLDFAAALTRLLTATLLGLLAGSPCECRSPTR