Rv0658c Family assigned · medium auto-curated

H37Rv Rv0658c · MTBC0 mtbc0_000696 · 238 aa · 757779–758495 (-) · RefSeq NP_215172.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)integral membrane protein
MTBC0 PGAP re-annotationCPBP family intramembrane glutamic endopeptidase
Revised (this work)CPBP family intramembrane glutamic endopeptidase. Pfam: Rce1-like (PF02517.22).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O06781 TrEMBL · unreviewed · Predicted
UniProt nameProbable conserved integral membrane protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionCAAX protease self-immunity
Orthologous groupCOG1266
KEGG orthology K07052

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.437 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 7 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Rce1-likePF02517.22 3.8e-16133–222 Type II CAAX prenyl endopeptidase Rce1-like

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: eccD1 (ESX-1 secretion system protein EccD1), high confidence from genomic context alone (score 722 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3877 eccD1 ESX-1 secretion system protein EccD1 721 722 ctx cooccurence:719
Rv3882c eccE1 ESX-1 secretion system protein EccE1 719 719 ctx cooccurence:715
Rv1632c hyp hypothetical protein 647 648 ctx cooccurence:639
Rv1375 hyp hypothetical protein 654 633 coexpression:620
Rv0657c vapB6 antitoxin VapB6 621 621 ctx neighborhood:615
Rv3912 rsmA anti-sigma-M factor RsmA 605 605 ctx cooccurence:592
Rv3875 esxA ESAT-6 protein EsxA 556 556 ctx cooccurence:555
Rv2360c hyp hypothetical protein 547 547 ctx cooccurence:526
Rv3737 transmembrane protein 544 544 ctx cooccurence:541
Rv3212 hyp hypothetical protein 533 534 ctx cooccurence:520
Rv3879c espK ESX-1 secretion-associated protein EspK 532 531 ctx cooccurence:530
Rv3869 eccB1 ESX-1 secretion system protein EccB 529 528 ctx cooccurence:505
Rv0556 transmembrane protein 521 521 ctx cooccurence:508
Rv3262 fbiB coenzyme F420:L-glutamate ligase 523 506 coexpression:400
Rv3438 hyp hypothetical protein 503 503 ctx cooccurence:502

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: integral membrane protein
  • MTBC0 PGAP product: CPBP family intramembrane glutamic endopeptidase
  • Pfam (hmmscan --cut_ga): Rce1-like PF02517.22 (E=4e-16)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215172.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Rce1-like (PF02517.22)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1266
  • Curated reference: UniProt O06781 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 49 functional partner(s); context anchor eccD1
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000696|Rv0658c|
MEAGRADTVAPSHRWGLGAFLVVELVFLVASTSLAVVLTGHGPVSAGVLALALAAPTVVAAGLAILITRLRGNGPRTDLRLRWSWRGLRLGLMFGFGGMLVTIPASLVYTAIVGPEANSAVVRIFGGVRASWPWALVVFLVVVFVAPLCEEIIYRGLLWGAVDRRWGRWAALVVTTVVFALAHLEFARAPLLVVVAIPIALARFYSGGLLASIVTHQVTNLLPGIVLLLGLTGAISLP