vapC6 Resolved · medium auto-curated

H37Rv Rv0656c · MTBC0 mtbc0_000694 · 127 aa · 757070–757453 (-) · RefSeq NP_215170.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ribonuclease VapC6
MTBC0 PGAP re-annotationribonuclease VapC6
Revised (this work)Ribonuclease VapC6.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WFB5 SwissProt · reviewed · Inferred from homology
UniProt nameRibonuclease VapC6
EC (curated) EC 3.1.-.-
Curated functionToxic component of a type II type II toxin-antitoxin (TA) system. An RNase. The cognate antitoxin is VapB6 (By similarity).

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionToxic component of a toxin-antitoxin (TA) module. An RNase
Orthologous groupCOG1487

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 6 missense, 1 nonsense, 0 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.15% of strains (214) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: vapB6 (antitoxin VapB6), medium confidence from genomic context alone (score 680 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0657c vapB6 antitoxin VapB6 680 680 ctx neighborhood:599
Rv0300 vapB2 antitoxin VapB2 434 435 experimental:412
Rv0658c integral membrane protein 416 416 ctx neighborhood:407
Rv2601A vapB41 antitoxin VapB41 431 409
Rv1952 vapB14 antitoxin VapB14 429 407
Rv1720c vapC12 ribonuclease VapC12 675 74 textmining:664
Rv2103c vapC37 ribonuclease VapC37 536 55 textmining:530
Rv0277c vapC25 ribonuclease VapC25 444 53 textmining:437
Rv1102c mazF3 mRNA interferase MazF3 441 53 textmining:434
Rv2526 vapB17 antitoxin VapB17 655 51 textmining:652
Rv2274c mazF8 toxin MazF8 575 51 textmining:571
Rv2602 vapC41 ribonuclease VapC41 656 48 textmining:654
Rv3408 vapC47 ribonuclease VapC47 653 48 textmining:651
Rv0549c vapC3 ribonuclease VapC3 561 48 textmining:558
Rv1397c vapC10 ribonuclease VapC10 658 47 textmining:656

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ribonuclease VapC6
  • MTBC0 PGAP product: ribonuclease VapC6
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215170.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1487
  • Curated reference: UniProt P9WFB5 (SwissProt, reviewed; Inferred from homology)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 18 functional partner(s); context anchor vapB6
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000694|Rv0656c|vapC6
MAAATTTGTHRGLELRAAQRAVGSCEPQRAEFCRSARNADEFDQMSRMFGDVYPDVPVPKSVWRWIDSAQHRLARAGAVGALSVVDLLICDTAAARGLVVLHDDADYELAERHLPDIRVRRVVSADD