ssd Resolved · high auto-curated

H37Rv Rv3660c · MTBC0 mtbc0_003878 · 350 aa · 4121926–4122978 (-) · RefSeq NP_218177.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationseptum site-determining protein Ssd
Revised (this work)Septum site-determining protein Ssd. Pfam: Rv3660c_N (PF26563.1).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WKX7 SwissProt · reviewed · Evidence at transcript level
UniProt nameUncharacterized protein Rv3660c
Curated functionMay play a role in septum formation.

UniProt still lists this protein as Uncharacterized protein Rv3660c; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category D Cell cycle control, cell division, chromosome partitioning
Preferred namecpaE
eggNOG descriptionbacterial-type flagellum organization
Orthologous groupCOG0455
Gene Ontology (10) GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0008150, GO:0040007, GO:0044424, GO:0044444, GO:0044464

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.449 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 7 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.11% of strains (157) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Rv3660c_NPF26563.1 1.4e-351–109 Rv3660c-like, CheY-like N-terminal domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv3659c (conjugal transfer protein), high confidence from genomic context alone (score 954 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3659c conjugal transfer protein 977 954 ctx neighborhood:773 coexpression:806 textmining:531
Rv3657c membrane protein 980 903 ctx neighborhood:754 cooccurence:599 textmining:810
Rv3658c transmembrane protein 875 871 ctx neighborhood:773
Rv3656c hyp hypothetical protein 950 758 ctx neighborhood:754 textmining:803
Rv0990c hyp hypothetical protein 754 754 ctx cooccurence:740
Rv3654c hyp hypothetical protein 858 722 ctx neighborhood:720 textmining:511
Rv2862c hyp hypothetical protein 539 539 ctx cooccurence:539
Rv3780 bpa hyp hypothetical protein 539 539 ctx cooccurence:539
Rv3655c hyp hypothetical protein 540 528 ctx neighborhood:521
Rv3118 sseC1 hyp hypothetical protein 509 509 ctx cooccurence:509
Rv0814c sseC2 hyp hypothetical protein 509 509 ctx cooccurence:509
Rv3286c sigF RNA polymerase sigma factor SigF 545 505 coexpression:420
Rv0051 transmembrane protein 474 474 ctx cooccurence:471
Rv1332 transcriptional regulator 470 471 ctx cooccurence:469
Rv1211 hyp hypothetical protein 459 459 ctx cooccurence:459

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: septum site-determining protein Ssd
  • Pfam (hmmscan --cut_ga): Rv3660c_N PF26563.1 (E=1e-35)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218177.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Rv3660c_N (PF26563.1)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0455
  • Curated reference: UniProt P9WKX7 (SwissProt, reviewed; Evidence at transcript level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 29 functional partner(s); context anchor Rv3659c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003878|Rv3660c|ssd
MLTDPGLRDELDRVAAAVGVRVVHLGGRHPVSRKTWSAAAAVVLDHAAADRCGRLALPRRTHVSVLTGTEAATATWAAAITVGAQHVLRMPEQEGELVRELAEAAESARDDGICGAVVAVIGGRGGAGASLFAVALAQAAADALLVDLDPWAGGIDLLVGGETAPGLRWPDLALQGGRLNWSAVRAALPRPRGISVLSGTRRGYELDAGPVDAVIDAGRRGGVTVVCDLPRRLTDATQAALDAADLVVLVSPCDVRACAAAATMAPVLTAINPNLGLVVRGPSPGGLRAAEVADVAGVPLLASMRAQPRLAEQLEHGGLRLRRRSVLASAARRVLGVLPRAGSGRHGRAA