Rv2034 Family assigned · medium auto-curated
H37Rv Rv2034 · MTBC0 mtbc0_002167 ·
107 aa · 2309907–2310230 (+) ·
RefSeq NP_216550.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | ArsR family HTH-type transcriptional repressor |
|---|---|
| MTBC0 PGAP re-annotation | metalloregulator ArsR/SmtB family transcription factor |
| Revised (this work) | Metalloregulator ArsR/SmtB family transcription factor. Pfam: HTH_20 (PF12840.14), HTH_5 (PF01022.27), MarR_2 (PF12802.14). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O53478
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | HTH-type transcriptional regulator Rv2034 |
| Curated function | Involved in the regulation of lipid metabolism and hypoxic response. Positively regulates transcription of various genes, such as phoP, groEL2 and dosR. Negatively regulates its own transcription. Acts by binding to a specific palindromic sequence motif in promoter regions. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
K Transcription
|
|---|---|
| eggNOG description | arsR family |
| Orthologous group | COG0640 |
| Gene Ontology (35) |
GO:0001067, GO:0003674, GO:0003676, GO:0003677, GO:0005488, GO:0006355, GO:0008150, GO:0009889, GO:0010468, GO:0010556, GO:0010565, GO:0019216 +23 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
HTH_20 | PF12840.14 | 1.5e-11 | 14–60 | Helix-turn-helix domain |
HTH_5 | PF01022.27 | 4.7e-13 | 16–60 | Bacterial regulatory protein, arsR family |
MarR_2 | PF12802.14 | 4.4e-06 | 26–65 | MarR family |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: sigI (ECF RNA polymerase sigma factor SigI), medium confidence from genomic context alone (score 587 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2035 hyp |
hypothetical protein | 970 | 942 ctx | neighborhood:882 cooccurence:493 textmining:510 |
Rv2036 hyp |
hypothetical protein | 893 | 886 ctx | neighborhood:882 |
Rv1189 sigI |
ECF RNA polymerase sigma factor SigI | 631 | 587 ctx | cooccurence:582 |
Rv3328c sigJ |
ECF RNA polymerase sigma factor SigJ | 618 | 574 ctx | cooccurence:571 |
Rv2033c hyp |
hypothetical protein | 606 | 548 ctx | neighborhood:546 |
Rv1994c cmtR |
HTH-type transcriptional regulator CmtR | 552 | 313 | |
Rv1049 |
transcriptional repressor | 458 | 298 | |
Rv3173c |
TetR/Acr family transcriptional regulator | 438 | 275 | |
Rv2640c |
ArsR family transcriptional regulator | 652 | 264 | textmining:547 |
Rv1353c |
HTH-type transcriptional regulator | 410 | 174 | |
Rv1990c mbcA |
transcriptional regulator | 644 | 85 | textmining:627 |
Rv1989c mbcT hyp |
hypothetical protein | 457 | 83 | textmining:433 |
Rv3574 kstR |
HTH-type transcriptional regulator KstR | 601 | 63 | textmining:592 |
Rv2865 relF |
antitoxin RelF | 657 | 58 | textmining:651 |
Rv0023 |
transcriptional regulator | 502 | 58 | textmining:493 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: ArsR family HTH-type transcriptional repressor
- MTBC0 PGAP product: metalloregulator ArsR/SmtB family transcription factor
- Pfam (hmmscan --cut_ga): HTH_20 PF12840.14 (E=1e-11), HTH_5 PF01022.27 (E=5e-13), MarR_2 PF12802.14 (E=4e-06)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216550.1)
- Domains: Pfam-A via hmmscan --cut_ga — HTH_20 (PF12840.14), HTH_5 (PF01022.27), MarR_2 (PF12802.14)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0640 - Curated reference: UniProt O53478 (SwissProt, reviewed; Evidence at protein level)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
23 functional partner(s); context anchor
sigI - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002167|Rv2034| MSTYRSPDRAWQALADGTRRAIVERLAHGPLAVGELARDLPVSRPAVSQHLKVLKTARLVCDRPAGTRRVYQLDPTGLAALRTDLDRFWTRALTGYAQLIDSEGDDT