Rv2034 Family assigned · medium auto-curated
H37Rv Rv2034 · MTBC0 mtbc0_002167 ·
107 aa ·
2309907–2310230 MTBC0
(+) ·
RefSeq NP_216550.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | ArsR family HTH-type transcriptional repressor |
|---|---|
| MTBC0 PGAP re-annotation | metalloregulator ArsR/SmtB family transcription factor |
| Revised (this work) | Metalloregulator ArsR/SmtB family transcription factor. Pfam: HTH_20 (PF12840.14), HTH_5 (PF01022.27), MarR_2 (PF12802.14). |
| Functional category (TubercuList) | regulatory proteins |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 13 publications
13 TB publications mention this gene. 13 publication(s) discuss this gene (13 in a M. tuberculosis context, 2 in other mycobacteria — M. smegmatis (1)).
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 1 % of gene
| Neighbour | Rv2035 (Rv2035, + strand) |
|---|---|
| Overlap | 4 bp, 1 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index 0.13 (95% CI -0.87 to 1.31). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Involved in transcriptional regulation. |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb2060
· 99.1% identity |
|---|---|
| M. marinum |
MMAR_2816
· 39.4% identity |
| M. smegmatis |
MSMEG_4175
· 39.2% identity |
| M. orygis |
RJtmp_002106
· 99.1% identity |
| M. abscessus |
MAB_4426
· 40.5% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
O53478
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | HTH-type transcriptional regulator Rv2034 |
| Curated function | Involved in the regulation of lipid metabolism and hypoxic response. Positively regulates transcription of various genes, such as phoP, groEL2 and dosR. Negatively regulates its own transcription. Acts by binding to a specific palindromic sequence motif in promoter regions. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
K Transcription
|
|---|---|
| eggNOG description | arsR family |
| Orthologous group | COG0640 |
| Gene Ontology (35) |
GO:0001067, GO:0003674, GO:0003676, GO:0003677, GO:0005488, GO:0006355, GO:0008150, GO:0009889, GO:0010468, GO:0010556, GO:0010565, GO:0019216 +23 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Outgroup conservation (beyond the MTBC) Bacteria
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 51/53 (96%) · mean identity 59.8%
· 4/4 closest MTBAP relatives conserved across the genus (present in 51/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
|---|---|
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 7/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 42.7% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 3 in the ORF — 0 in the essential state, 0 growth-defect, 3 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 29. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | Statistically thin call: only 3 TA (Himar1) sites in the whole ORF (atlas median 13; genes under 300 nt typically have very few). A DeJesus 2017 call built on so few independent observations is less robust than the same call on a longer gene, in either direction. Cross-check against the CRISPRi vulnerability index (independent of TA-site density) and, if this gene overlaps a neighbour (see Genomic-neighbour overlap section below), verify how many of its TA sites actually fall inside its own ORF. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 9 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 11.9 ppm · rank 2604/3519 (26.0th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 107 aa |
|---|---|
| Molecular weight | 11.9 kDa |
| Theoretical pI | 9.5 |
| GRAVY | -0.384 (hydrophilic) |
| Aliphatic index | 90.4 |
| Aromaticity | 0.056 |
| Instability index | 37.6 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
HTH_20 | PF12840.14 | 1.5e-11 | 14–60 | Helix-turn-helix domain |
HTH_5 | PF01022.27 | 4.7e-13 | 16–60 | Bacterial regulatory protein, arsR family |
MarR_2 | PF12802.14 | 4.4e-06 | 26–65 | MarR family |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 91.0
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
7p6f-assembly1_BBB |
1.00 | 0.94 | 2.4e-07 sig | 7p6f-assembly1_BBB 1.93 A resolution X-ray crystal structure of the transcriptional regulator SrnR from Streptomyces griseus |
3f6v-assembly1_A-2 |
1.00 | 0.92 | 2.3e-07 sig | 3f6v-assembly1_A-2 Crystal structure of Possible transcriptional regulator for arsenical resistance |
7p6f-assembly2_CCC-2 |
1.00 | 0.84 | 7.3e-08 sig | 7p6f-assembly2_CCC-2 1.93 A resolution X-ray crystal structure of the transcriptional regulator SrnR from Streptomyces griseus |
3f6o-assembly1_B |
1.00 | 0.91 | 5.3e-07 sig | 3f6o-assembly1_B Crystal structure of ArsR family transcriptional regulator, RHA00566 |
1r1u-assembly1_B |
1.00 | 0.83 | 3.2e-06 sig | 1r1u-assembly1_B Crystal structure of the metal-sensing transcriptional repressor CzrA from Staphylococcus aureus in the apo-form |
Foldseek search of the AlphaFold DB model (mean pLDDT 91.0, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 3
| Upstream (5' on genome) | Rv2033c (- strand, 211 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv2035 (+ strand, -4 bp gap) |
| Predicted operon |
Rv2034 · Rv2035 · Rv2036
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE) transcription factor
| Regulated by (4 TF) |
Rv0023 (activates) · Rv0081 (activates) · Rv0576 (represses) · Rv2034 (activates)
|
|---|---|
| Regulon | this transcription factor regulates 127 target gene(s) |
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: sigI (ECF RNA polymerase sigma factor SigI), medium confidence from genomic context alone (score 587 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2035 hyp |
hypothetical protein | 970 | 942 ctx | neighborhood:882 cooccurence:493 textmining:510 |
Rv2036 hyp |
hypothetical protein | 893 | 886 ctx | neighborhood:882 |
Rv1189 sigI |
ECF RNA polymerase sigma factor SigI | 631 | 587 ctx | cooccurence:582 |
Rv3328c sigJ |
ECF RNA polymerase sigma factor SigJ | 618 | 574 ctx | cooccurence:571 |
Rv2033c hyp |
hypothetical protein | 606 | 548 ctx | neighborhood:546 |
Rv1994c cmtR |
HTH-type transcriptional regulator CmtR | 552 | 313 | |
Rv1049 |
transcriptional repressor | 458 | 298 | |
Rv3173c |
TetR/Acr family transcriptional regulator | 438 | 275 | |
Rv2640c |
ArsR family transcriptional regulator | 652 | 264 | textmining:547 |
Rv1353c |
HTH-type transcriptional regulator | 410 | 174 | |
Rv1990c mbcA |
transcriptional regulator | 644 | 85 | textmining:627 |
Rv1989c mbcT hyp |
hypothetical protein | 457 | 83 | textmining:433 |
Rv3574 kstR |
HTH-type transcriptional regulator KstR | 601 | 63 | textmining:592 |
Rv2865 relF |
antitoxin RelF | 657 | 58 | textmining:651 |
Rv0023 |
transcriptional regulator | 502 | 58 | textmining:493 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: ArsR family HTH-type transcriptional repressor
- MTBC0 PGAP product: metalloregulator ArsR/SmtB family transcription factor
- Pfam (hmmscan --cut_ga): HTH_20 PF12840.14 (E=1e-11), HTH_5 PF01022.27 (E=5e-13), MarR_2 PF12802.14 (E=4e-06)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216550.1)
- Domains: Pfam-A via hmmscan --cut_ga — HTH_20 (PF12840.14), HTH_5 (PF01022.27), MarR_2 (PF12802.14)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0640 - Curated reference: UniProt O53478 (SwissProt, reviewed; Evidence at protein level)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 91.0)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
23 functional partner(s); context anchor
sigI - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002167|Rv2034| MSTYRSPDRAWQALADGTRRAIVERLAHGPLAVGELARDLPVSRPAVSQHLKVLKTARLVCDRPAGTRRVYQLDPTGLAALRTDLDRFWTRALTGYAQLIDSEGDDT
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for Rv2034? Email the maintainer — the message is pre-filled with this gene's details.