Rv2034 Family assigned · medium auto-curated

H37Rv Rv2034 · MTBC0 mtbc0_002167 · 107 aa · 2309907–2310230 (+) · RefSeq NP_216550.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ArsR family HTH-type transcriptional repressor
MTBC0 PGAP re-annotationmetalloregulator ArsR/SmtB family transcription factor
Revised (this work)Metalloregulator ArsR/SmtB family transcription factor. Pfam: HTH_20 (PF12840.14), HTH_5 (PF01022.27), MarR_2 (PF12802.14).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53478 SwissProt · reviewed · Evidence at protein level
UniProt nameHTH-type transcriptional regulator Rv2034
Curated functionInvolved in the regulation of lipid metabolism and hypoxic response. Positively regulates transcription of various genes, such as phoP, groEL2 and dosR. Negatively regulates its own transcription. Acts by binding to a specific palindromic sequence motif in promoter regions.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
eggNOG descriptionarsR family
Orthologous groupCOG0640
Gene Ontology (35) GO:0001067, GO:0003674, GO:0003676, GO:0003677, GO:0005488, GO:0006355, GO:0008150, GO:0009889, GO:0010468, GO:0010556, GO:0010565, GO:0019216 +23 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
HTH_20PF12840.14 1.5e-1114–60 Helix-turn-helix domain
HTH_5PF01022.27 4.7e-1316–60 Bacterial regulatory protein, arsR family
MarR_2PF12802.14 4.4e-0626–65 MarR family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: sigI (ECF RNA polymerase sigma factor SigI), medium confidence from genomic context alone (score 587 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2035 hyp hypothetical protein 970 942 ctx neighborhood:882 cooccurence:493 textmining:510
Rv2036 hyp hypothetical protein 893 886 ctx neighborhood:882
Rv1189 sigI ECF RNA polymerase sigma factor SigI 631 587 ctx cooccurence:582
Rv3328c sigJ ECF RNA polymerase sigma factor SigJ 618 574 ctx cooccurence:571
Rv2033c hyp hypothetical protein 606 548 ctx neighborhood:546
Rv1994c cmtR HTH-type transcriptional regulator CmtR 552 313
Rv1049 transcriptional repressor 458 298
Rv3173c TetR/Acr family transcriptional regulator 438 275
Rv2640c ArsR family transcriptional regulator 652 264 textmining:547
Rv1353c HTH-type transcriptional regulator 410 174
Rv1990c mbcA transcriptional regulator 644 85 textmining:627
Rv1989c mbcT hyp hypothetical protein 457 83 textmining:433
Rv3574 kstR HTH-type transcriptional regulator KstR 601 63 textmining:592
Rv2865 relF antitoxin RelF 657 58 textmining:651
Rv0023 transcriptional regulator 502 58 textmining:493

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ArsR family HTH-type transcriptional repressor
  • MTBC0 PGAP product: metalloregulator ArsR/SmtB family transcription factor
  • Pfam (hmmscan --cut_ga): HTH_20 PF12840.14 (E=1e-11), HTH_5 PF01022.27 (E=5e-13), MarR_2 PF12802.14 (E=4e-06)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216550.1)
  • Domains: Pfam-A via hmmscan --cut_ga — HTH_20 (PF12840.14), HTH_5 (PF01022.27), MarR_2 (PF12802.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0640
  • Curated reference: UniProt O53478 (SwissProt, reviewed; Evidence at protein level)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 23 functional partner(s); context anchor sigI
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002167|Rv2034|
MSTYRSPDRAWQALADGTRRAIVERLAHGPLAVGELARDLPVSRPAVSQHLKVLKTARLVCDRPAGTRRVYQLDPTGLAALRTDLDRFWTRALTGYAQLIDSEGDDT