Rv3118 Family assigned · medium auto-curated

H37Rv Rv3118 · MTBC0 - · 100 aa · 3484809–3485111 (+) · RefSeq YP_177930.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Contains DUF1416 (PF07210.19), CarboxypepD_reg (PF13620.13) domain(s); putative function inferred from the domain architecture.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P0CG96 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized protein Rv3118

UniProt still lists this protein as Uncharacterized protein Rv3118; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred namesseC
eggNOG descriptionProtein of unknown function (DUF1416)
Orthologous group2E36U
Gene Ontology (8) GO:0005575, GO:0005618, GO:0005623, GO:0005886, GO:0016020, GO:0030312, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF1416PF07210.19 3.0e-422–99 Protein of unknown function (DUF1416)
CarboxypepD_regPF13620.13 5.9e-1023–84 Carboxypeptidase regulatory-like domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: cysA3 (thiosulfate sulfurtransferase), high confidence from genomic context alone (score 844 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3117 cysA3 thiosulfate sulfurtransferase 972 844 ctx neighborhood:789 textmining:828
Rv0815c cysA2 thiosulfate sulfurtransferase CysA 942 816 coexpression:744 textmining:701
Rv2844 hyp hypothetical protein 727 728 ctx cooccurence:726
Rv3119 moaE1 molybdopterin synthase catalytic subunit 1 943 723 ctx neighborhood:716 textmining:803
Rv3120 hyp hypothetical protein 722 721 ctx neighborhood:716
Rv2468c hyp hypothetical protein 687 688 ctx cooccurence:683
Rv3116 moeB2 molybdenum cofactor biosynthesis protein MoeB 682 681 ctx neighborhood:679
Rv2365c hyp hypothetical protein 638 638 ctx cooccurence:636
Rv1332 transcriptional regulator 627 628 ctx cooccurence:624
Rv3304 hyp hypothetical protein 601 602 ctx cooccurence:599
Rv0051 transmembrane protein 588 588 ctx cooccurence:582
Rv3013 hyp hypothetical protein 560 560 ctx cooccurence:558
Rv0487 hyp hypothetical protein 535 536 ctx cooccurence:533
Rv3231c hyp hypothetical protein 526 526 ctx cooccurence:519
Rv3660c ssd hyp hypothetical protein 509 509 ctx cooccurence:509

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
  • Pfam (hmmscan --cut_ga): DUF1416 PF07210.19 (E=3e-42), CarboxypepD_reg PF13620.13 (E=6e-10)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177930.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF1416 (PF07210.19), CarboxypepD_reg (PF13620.13)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2E36U
  • Curated reference: UniProt P0CG96 (SwissProt, reviewed; Evidence at protein level)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 42 functional partner(s); context anchor cysA3
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv3118|
MCSGPKQGLTLPASVDLEKETVITGRVVDGDGQAVGGAFVRLLDSSDEFTAEVVASATGDFRFFAAPGSWTLRALSAAGNGDAVVQPSGAGIHEVDVKIT