Rv3118 Family assigned · medium auto-curated
H37Rv Rv3118 · MTBC0 - ·
100 aa · 3484809–3485111 (+) ·
RefSeq YP_177930.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Contains DUF1416 (PF07210.19), CarboxypepD_reg (PF13620.13) domain(s); putative function inferred from the domain architecture. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
P0CG96
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Uncharacterized protein Rv3118 |
UniProt still lists this protein as Uncharacterized protein Rv3118; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| Preferred name | sseC |
| eggNOG description | Protein of unknown function (DUF1416) |
| Orthologous group | 2E36U |
| Gene Ontology (8) |
GO:0005575, GO:0005618, GO:0005623, GO:0005886, GO:0016020, GO:0030312, GO:0044464, GO:0071944
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
DUF1416 | PF07210.19 | 3.0e-42 | 2–99 | Protein of unknown function (DUF1416) |
CarboxypepD_reg | PF13620.13 | 5.9e-10 | 23–84 | Carboxypeptidase regulatory-like domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: cysA3 (thiosulfate sulfurtransferase), high confidence from genomic context alone (score 844 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3117 cysA3 |
thiosulfate sulfurtransferase | 972 | 844 ctx | neighborhood:789 textmining:828 |
Rv0815c cysA2 |
thiosulfate sulfurtransferase CysA | 942 | 816 | coexpression:744 textmining:701 |
Rv2844 hyp |
hypothetical protein | 727 | 728 ctx | cooccurence:726 |
Rv3119 moaE1 |
molybdopterin synthase catalytic subunit 1 | 943 | 723 ctx | neighborhood:716 textmining:803 |
Rv3120 hyp |
hypothetical protein | 722 | 721 ctx | neighborhood:716 |
Rv2468c hyp |
hypothetical protein | 687 | 688 ctx | cooccurence:683 |
Rv3116 moeB2 |
molybdenum cofactor biosynthesis protein MoeB | 682 | 681 ctx | neighborhood:679 |
Rv2365c hyp |
hypothetical protein | 638 | 638 ctx | cooccurence:636 |
Rv1332 |
transcriptional regulator | 627 | 628 ctx | cooccurence:624 |
Rv3304 hyp |
hypothetical protein | 601 | 602 ctx | cooccurence:599 |
Rv0051 |
transmembrane protein | 588 | 588 ctx | cooccurence:582 |
Rv3013 hyp |
hypothetical protein | 560 | 560 ctx | cooccurence:558 |
Rv0487 hyp |
hypothetical protein | 535 | 536 ctx | cooccurence:533 |
Rv3231c hyp |
hypothetical protein | 526 | 526 ctx | cooccurence:519 |
Rv3660c ssd hyp |
hypothetical protein | 509 | 509 ctx | cooccurence:509 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
- Pfam (hmmscan --cut_ga): DUF1416 PF07210.19 (E=3e-42), CarboxypepD_reg PF13620.13 (E=6e-10)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177930.1)
- Domains: Pfam-A via hmmscan --cut_ga — DUF1416 (PF07210.19), CarboxypepD_reg (PF13620.13)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2E36U - Curated reference: UniProt P0CG96 (SwissProt, reviewed; Evidence at protein level)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
42 functional partner(s); context anchor
cysA3 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv3118| MCSGPKQGLTLPASVDLEKETVITGRVVDGDGQAVGGAFVRLLDSSDEFTAEVVASATGDFRFFAAPGSWTLRALSAAGNGDAVVQPSGAGIHEVDVKIT