dppB Family assigned · medium auto-curated

H37Rv Rv3665c · MTBC0 mtbc0_003883 · 308 aa · 4128361–4129287 (-) · RefSeq NP_218182.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)dipeptide ABC transporter permease DppB
MTBC0 PGAP re-annotationABC transporter permease
Revised (this work)ABC transporter permease. Pfam: BPD_transp_1_N (PF19300.5), BPD_transp_1 (PF00528.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6YGV9 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable dipeptide-transport integral membrane protein ABC transporter DppB

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category P Inorganic ion transport and metabolism
Preferred namedppB
eggNOG descriptionABC transporter
Orthologous groupCOG0601
KEGG orthology K02033, K15581
KEGG pathways map01501, map02010, map02024
KEGG modules M00239, M00439

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.333 · purifying
Polymorphic sites (≥ 0.1% of strains) 6 synonymous, 5 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
BPD_transp_1_NPF19300.5 6.1e-064–77 Binding-prot-dependent transport system membrane comp, N-term
BPD_transp_1PF00528.28 1.7e-34113–306 Binding-protein-dependent transport system inner membrane component

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: dppC (dipeptide ABC transporter permease DppC), high confidence from genomic context alone (score 999 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3664c dppC dipeptide ABC transporter permease DppC 999 999 ctx neighborhood:807 cooccurence:774 coexpression:678 database:900 textmining:458
Rv3666c dppA dipeptide ABC transporter substrate-binding lipoprotein DppA 998 998 ctx neighborhood:882 cooccurence:772 coexpression:475 database:900
Rv3663c dppD dipeptide ABC transporter ATP-binding protein DppD 999 997 ctx neighborhood:807 cooccurence:771 coexpression:478 database:900 textmining:732
Rv1282c oppC oligopeptide ABC transporter permease OppC 973 949 ctx cooccurence:774 coexpression:668 textmining:498
Rv1281c oppD oligopeptide ABC transporter ATP-binding protein OppD 877 864 ctx cooccurence:761
Rv3662c hyp hypothetical protein 886 808 ctx neighborhood:807 textmining:433
Rv1280c oppA oligopeptide ABC transporter substrate-binding lipoprotein OppA 793 627 coexpression:459 textmining:469
Rv3667 acs acetyl-CoAsynthetase 553 554 ctx neighborhood:544
Rv2585c lipoprotein 591 546 coexpression:456
Rv1166 lpqW monoacyl phosphatidylinositol tetramannoside-binding protein LpqW 564 537 coexpression:458
Rv2326c ABC transporter ATP-binding protein 671 530 coexpression:470
Rv3104c transmembrane protein 504 77 textmining:485

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: dipeptide ABC transporter permease DppB
  • MTBC0 PGAP product: ABC transporter permease
  • Pfam (hmmscan --cut_ga): BPD_transp_1_N PF19300.5 (E=6e-06), BPD_transp_1 PF00528.28 (E=2e-34)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218182.1)
  • Domains: Pfam-A via hmmscan --cut_ga — BPD_transp_1_N (PF19300.5), BPD_transp_1 (PF00528.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0601
  • Curated reference: UniProt I6YGV9 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 12 functional partner(s); context anchor dppC
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003883|Rv3665c|dppB
MGWYVARRVAVMVPVFLGATLLIYGMVFLLPGDPVAALAGDRPLTPAVAAQLRSHYHLDDPFLVQYLRYLGGILHGDLGRAYSGLPVSAVLAHAFPVTIRLALIALAVEAVLGIGFGVIAGLRQGGIFDSAVLVTGLVIIAIPIFVLGFLAQFLFGVQLEIAPVTVGERASVGRLLLPGIVLGAMSFAYVVRLTRSAVAANAHADYVRTATAKGLSRPRVVTVHILRNSLIPVVTFLGADLGALMGGAIVTEGIFNIHGVGGVLYQAVTRQETPTVVSIVTVLVLIYLITNLLVDLLYAALDPRIRYG