dppB Family assigned · medium auto-curated

H37Rv Rv3665c · MTBC0 mtbc0_003883 · 308 aa · 4128361–4129287 MTBC0 (-) · RefSeq NP_218182.1

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)dipeptide ABC transporter permease DppB
MTBC0 PGAP re-annotationABC transporter permease
Revised (this work)ABC transporter permease. Pfam: BPD_transp_1_N (PF19300.5), BPD_transp_1 (PF00528.28).
Functional category (TubercuList)cell wall and cell processes

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 6 publications

6 TB publications mention this gene. 6 publication(s) discuss this gene (6 in a M. tuberculosis context, 1 in other mycobacteria — M. smegmatis (1)).

Most recent 5 of 6.
PublicationDate
Structural characterization of the ABC transporter DppABCDF in Escherichia coli reveals insights into dipeptide acquisition. doi:10.1371/journal.pbio.3003026 2025
A Nanostructured Lipid System to Improve the Oral Bioavailability of Ruthenium(II) Complexes for the Treatment of Infections Caused by Mycobacterium tuberculosis. doi:10.3389/fmicb.2018.02930 2018
Ru(II)/clotrimazole/diphenylphosphine/bipyridine complexes: Interaction with DNA, BSA and biological potential against tumor cell lines and Mycobacterium tuberculosis. doi:10.1016/j.jinorgbio.2016.06.023 2016
Ruthenium(II) phosphine/diimine/picolinate complexes: inorganic compounds as agents against tuberculosis. doi:10.1016/j.ejmech.2011.08.023 2011
An oligopeptide transporter of Mycobacterium tuberculosis regulates cytokine release and apoptosis of infected macrophages. doi:10.1371/journal.pone.0012225 2010

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

CRISPRi vulnerability

Vulnerability index -0.40 (95% CI -4.89 to 5.43). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionInvolved in active transport of dipeptide across the membrane (import). Responsible for the translocation of the substrate across the membrane.

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb3689c · 100.0% identity
M. marinum MMAR_5153 · 89.3% identity
M. smegmatis MSMEG_6866 · 40.7% identity
M. orygis RJtmp_003764 · 100.0% identity
M. abscessus MAB_0427 · 52.3% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt I6YGV9 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable dipeptide-transport integral membrane protein ABC transporter DppB

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category P Inorganic ion transport and metabolism
Preferred namedppB
eggNOG descriptionABC transporter
Orthologous groupCOG0601
KEGG orthology K02033, K15581
KEGG pathways map01501, map02010, map02024
KEGG modules M00239, M00439

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.333 · purifying
Polymorphic sites (≥ 0.1% of strains) 6 synonymous, 5 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Bacteria

Genus-wide presence (~53 non-MTBC Mycobacterium) present in 53/53 (100%) · mean identity 85.3% · 4/4 closest MTBAP relatives
conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 13/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 51.0%
detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 17 in the ORF — 0 in the essential state, 0 growth-defect, 17 non-essential, 0 growth-advantage. Saturation 0.824, mean read count 43.2857142857. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype

Conditionlog2FCqEffect
fitness in mouse infection, day 45 (in vivo) -4.190.0 required

Conditional fitness of transposon-disruption mutants across 1 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.

Proteomics (mass spectrometry) detected

MS detectiondetected in 6 of 16 independent MS datasets
Integrated abundance0.92 ppm · rank 3287/3519 (6.6th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Predicted localisation (DeepTMHMM + lipobox)

Predictionpredicted membrane protein (6 TM helixes)
DeepTMHMM classTM
TM helices (DeepTMHMM)6

Transmembrane topology and signal peptide from DeepTMHMM (deep-learning reference predictor); lipoproteins from a (myco)bacterial lipobox motif. A sequence-based prediction of subcellular context.

Physico-chemical properties (computed, ProtParam)

Length308 aa
Molecular weight32.5 kDa
Theoretical pI9.64
GRAVY0.964 (hydrophobic)
Aliphatic index140.2
Aromaticity0.084
Instability index30.7 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
BPD_transp_1_NPF19300.5 6.1e-064–77 Binding-prot-dependent transport system membrane comp, N-term
BPD_transp_1PF00528.28 1.7e-34113–306 Binding-protein-dependent transport system inner membrane component

Experimental structures (Protein Data Bank) 4 solved

PDBMethodResolutionCoverage
8wdb Electron Microscopy 2.86 Å 100%
8wda Electron Microscopy 3.26 Å 100%
8wd9 Electron Microscopy 3.35 Å 100%
8xfc Electron Microscopy 3.89 Å 100%

Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (4 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 89.1

PDB hitprobTM-scoreE-valueDescription
8wd9-assembly1_B 1.00 0.92 8.1e-31 sig 8wd9-assembly1_B Cryo-EM structure of Mycobacterium tuberculosis DppABCD in apo form
8wda-assembly1_B 1.00 0.93 4.2e-29 sig 8wda-assembly1_B Cryo-EM structure of the substrate-bound DppABCD complex
8j5q-assembly1_B 1.00 0.86 8.3e-14 sig 8j5q-assembly1_B Cryo-EM structure of Mycobacterium tuberculosis OppABCD in the pre-translocation state
3tui-assembly2_E 1.00 0.75 7.6e-04 sig 3tui-assembly2_E Inward facing conformations of the MetNI methionine ABC transporter: CY5 native crystal form
8j5q-assembly1_C 1.00 0.71 8.6e-04 sig 8j5q-assembly1_C Cryo-EM structure of Mycobacterium tuberculosis OppABCD in the pre-translocation state

Foldseek search of the AlphaFold DB model (mean pLDDT 89.1, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 2

Upstream (5' on genome)dppC (- strand, 55 bp gap)
Downstream (3' on genome)dppA (- strand, 1 bp gap)
Predicted operon dppB · dppA

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: dppC (dipeptide ABC transporter permease DppC), high confidence from genomic context alone (score 999 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3664c dppC exp dipeptide ABC transporter permease DppC 999 999 ctx neighborhood:807 cooccurence:774 coexpression:678 database:900 textmining:458
Rv3666c dppA exp dipeptide ABC transporter substrate-binding lipoprotein DppA 998 998 ctx neighborhood:882 cooccurence:772 coexpression:475 database:900
Rv3663c dppD exp dipeptide ABC transporter ATP-binding protein DppD 999 997 ctx neighborhood:807 cooccurence:771 coexpression:478 database:900 textmining:732
Rv1282c oppC oligopeptide ABC transporter permease OppC 973 949 ctx cooccurence:774 coexpression:668 textmining:498
Rv1281c oppD oligopeptide ABC transporter ATP-binding protein OppD 877 864 ctx cooccurence:761
Rv3662c hyp hypothetical protein 886 808 ctx neighborhood:807 textmining:433
Rv1280c oppA oligopeptide ABC transporter substrate-binding lipoprotein OppA 793 627 coexpression:459 textmining:469
Rv3667 acs acetyl-CoAsynthetase 553 554 ctx neighborhood:544
Rv2585c lipoprotein 591 546 coexpression:456
Rv1166 lpqW monoacyl phosphatidylinositol tetramannoside-binding protein LpqW 564 537 coexpression:458
Rv2326c ABC transporter ATP-binding protein 671 530 coexpression:470
Rv3104c transmembrane protein 504 77 textmining:485

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: dipeptide ABC transporter permease DppB
  • MTBC0 PGAP product: ABC transporter permease
  • Pfam (hmmscan --cut_ga): BPD_transp_1_N PF19300.5 (E=6e-06), BPD_transp_1 PF00528.28 (E=2e-34)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218182.1)
  • Domains: Pfam-A via hmmscan --cut_ga — BPD_transp_1_N (PF19300.5), BPD_transp_1 (PF00528.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0601
  • Curated reference: UniProt I6YGV9 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 89.1)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 12 functional partner(s); context anchor dppC
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Predicted localisation: DeepTMHMM (Hallgren et al. 2022, doi:10.1101/2022.04.08.487609) for transmembrane topology and signal peptide
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003883|Rv3665c|dppB
MGWYVARRVAVMVPVFLGATLLIYGMVFLLPGDPVAALAGDRPLTPAVAAQLRSHYHLDDPFLVQYLRYLGGILHGDLGRAYSGLPVSAVLAHAFPVTIRLALIALAVEAVLGIGFGVIAGLRQGGIFDSAVLVTGLVIIAIPIFVLGFLAQFLFGVQLEIAPVTVGERASVGRLLLPGIVLGAMSFAYVVRLTRSAVAANAHADYVRTATAKGLSRPRVVTVHILRNSLIPVVTFLGADLGALMGGAIVTEGIFNIHGVGGVLYQAVTRQETPTVVSIVTVLVLIYLITNLLVDLLYAALDPRIRYG