Rv1332 Family assigned · low auto-curated

H37Rv Rv1332 · MTBC0 - · 218 aa · 1500926–1501582 (+) · RefSeq NP_215848.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transcriptional regulator
MTBC0 PGAP re-annotation
Revised (this work)Transcriptional regulator.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WM25 SwissProt · reviewed · Evidence at protein level
UniProt nameOxidative stress regulator AosR
Curated functionTranscription factor crucial for intra-mycobacterial redox homeostasis and protection against host-derived oxidative and nitrosative radicals. In response to oxidative stress, interacts with the ECF sigma factor SigH and, in conjunction with SigH, binds to an auxiliary promoter upstream of mec-cysO-cysM, leading to the transcriptional activation of these genes encoding a non-canonical actinomycete-specific cysteine biosynthesis pathway. Increased transcription of mec-cysO-cysM results in enhanced production of L-cysteine and cysteine-derived antioxidant molecules. Increased production of cyste.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionDomain of unknown function (DUF2017)
Orthologous group2E4AX

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.344 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF2017PF09438.17 1.1e-4232–214 Domain of unknown function (DUF2017)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: mec ([CysO), high confidence from genomic context alone (score 899 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1334 mec [CysO 899 899 ctx neighborhood:861
Rv1331 clpS ATP-dependent Clp protease adapter protein ClpS 910 897 ctx neighborhood:881
Rv1333 hydrolase 891 875 ctx neighborhood:861
Rv1337 integral membrane protein 890 874 ctx neighborhood:829
Rv1336 cysM O-phosphoserine sulfhydrylase 875 855 ctx neighborhood:829
Rv1335 cysO sulfur carrier protein CysO 838 838 ctx neighborhood:833
Rv1338 murI glutamate racemase 833 834 ctx neighborhood:829
Rv1339 hyp hypothetical protein 800 800 ctx neighborhood:797
Rv1340 rphA ribonuclease PH 789 790 ctx neighborhood:783
Rv1330c pncB1 nicotinic acid phosphoribosyltransferase PncB1 782 781 ctx neighborhood:780
Rv1828 HTH-type transcriptional regulator 779 771 coexpression:771
Rv0490 senX3 two component sensor histidine kinase SenX3 766 767 coexpression:732
Rv1329c dinG ATP-dependent helicase DinG 763 763 ctx neighborhood:762
Rv2446c integral membrane protein 756 757 ctx cooccurence:755
Rv1341 rdgB non-canonical purine NTP pyrophosphatase 751 751 ctx neighborhood:745

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): transcriptional regulator
  • Pfam (hmmscan --cut_ga): DUF2017 PF09438.17 (E=1e-42)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215848.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF2017 (PF09438.17)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2E4AX
  • Curated reference: UniProt P9WM25 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 86 functional partner(s); context anchor mec
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv1332|
MPPVCGRRCSRTGEIRGYSGSIVRRWKRVETRDGPRFRSSLAPHEAALLKNLAGAMIGLLDDRDSSSPSDELEEITGIKTGHAQRPGDPTLRRLLPDFYRPDDLDDDDPTAVDGSESFNAALRSLHEPEIIDAKRVAAQQLLDTVPDNGGRLELTESDANAWIAAVNDLRLALGVMLEIGPRGPERLPGNHPLAAHFNVYQWLTVLQEYLVLVLMGSR