Rv1332 Family assigned · low auto-curated
H37Rv Rv1332 · MTBC0 - ·
218 aa · 1500926–1501582 (+) ·
RefSeq NP_215848.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | transcriptional regulator |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Transcriptional regulator. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
P9WM25
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Oxidative stress regulator AosR |
| Curated function | Transcription factor crucial for intra-mycobacterial redox homeostasis and protection against host-derived oxidative and nitrosative radicals. In response to oxidative stress, interacts with the ECF sigma factor SigH and, in conjunction with SigH, binds to an auxiliary promoter upstream of mec-cysO-cysM, leading to the transcriptional activation of these genes encoding a non-canonical actinomycete-specific cysteine biosynthesis pathway. Increased transcription of mec-cysO-cysM results in enhanced production of L-cysteine and cysteine-derived antioxidant molecules. Increased production of cyste. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Domain of unknown function (DUF2017) |
| Orthologous group | 2E4AX |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.344 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
DUF2017 | PF09438.17 | 1.1e-42 | 32–214 | Domain of unknown function (DUF2017) |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: mec ([CysO), high confidence from genomic context alone (score 899 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1334 mec |
[CysO | 899 | 899 ctx | neighborhood:861 |
Rv1331 clpS |
ATP-dependent Clp protease adapter protein ClpS | 910 | 897 ctx | neighborhood:881 |
Rv1333 |
hydrolase | 891 | 875 ctx | neighborhood:861 |
Rv1337 |
integral membrane protein | 890 | 874 ctx | neighborhood:829 |
Rv1336 cysM |
O-phosphoserine sulfhydrylase | 875 | 855 ctx | neighborhood:829 |
Rv1335 cysO |
sulfur carrier protein CysO | 838 | 838 ctx | neighborhood:833 |
Rv1338 murI |
glutamate racemase | 833 | 834 ctx | neighborhood:829 |
Rv1339 hyp |
hypothetical protein | 800 | 800 ctx | neighborhood:797 |
Rv1340 rphA |
ribonuclease PH | 789 | 790 ctx | neighborhood:783 |
Rv1330c pncB1 |
nicotinic acid phosphoribosyltransferase PncB1 | 782 | 781 ctx | neighborhood:780 |
Rv1828 |
HTH-type transcriptional regulator | 779 | 771 | coexpression:771 |
Rv0490 senX3 |
two component sensor histidine kinase SenX3 | 766 | 767 | coexpression:732 |
Rv1329c dinG |
ATP-dependent helicase DinG | 763 | 763 ctx | neighborhood:762 |
Rv2446c |
integral membrane protein | 756 | 757 ctx | cooccurence:755 |
Rv1341 rdgB |
non-canonical purine NTP pyrophosphatase | 751 | 751 ctx | neighborhood:745 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): transcriptional regulator
- Pfam (hmmscan --cut_ga): DUF2017 PF09438.17 (E=1e-42)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215848.1)
- Domains: Pfam-A via hmmscan --cut_ga — DUF2017 (PF09438.17)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2E4AX - Curated reference: UniProt P9WM25 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
86 functional partner(s); context anchor
mec - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv1332| MPPVCGRRCSRTGEIRGYSGSIVRRWKRVETRDGPRFRSSLAPHEAALLKNLAGAMIGLLDDRDSSSPSDELEEITGIKTGHAQRPGDPTLRRLLPDFYRPDDLDDDDPTAVDGSESFNAALRSLHEPEIIDAKRVAAQQLLDTVPDNGGRLELTESDANAWIAAVNDLRLALGVMLEIGPRGPERLPGNHPLAAHFNVYQWLTVLQEYLVLVLMGSR