Rv3654c Family assigned · medium auto-curated

H37Rv Rv3654c · MTBC0 - · 107 aa · 4094660–4094983 (-) · RefSeq NP_218171.2

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Contains Tad (PF13400.12) domain(s); putative function inferred from the domain architecture.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt O69622 SwissProt · reviewed · Evidence at protein level
UniProt nameApoptosis inhibitor Rv3654c
Curated functionEffector protein that participates in the suppression of macrophage apoptosis by blocking the extrinsic pathway. Recognizes the host polypyrimidine tract binding protein-associated splicing factor (PSF), which probably leads to its cleavage, diminishing the level of caspase-8 in macrophages.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionTIGRFAM helicase secretion neighborhood TadE-like protein
Orthologous group2DRBM

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
TadPF13400.12 4.5e-081–43 Putative Flp pilus-assembly TadE/G-like

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv3659c (conjugal transfer protein), high confidence from genomic context alone (score 827 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3655c hyp hypothetical protein 886 886 ctx neighborhood:881
Rv3656c hyp hypothetical protein 968 853 ctx neighborhood:851 textmining:796
Rv3659c conjugal transfer protein 964 827 ctx neighborhood:824 textmining:803
Rv3658c transmembrane protein 827 827 ctx neighborhood:824
Rv3657c membrane protein 962 824 ctx neighborhood:813 textmining:796
Rv3660c ssd hyp hypothetical protein 858 722 ctx neighborhood:720 textmining:511
Rv3151 nuoG NADH-quinone oxidoreductase subunit G 543 47 textmining:541
Rv3364c hyp hypothetical protein 659 45 textmining:658
Rv1821 secA2 accessory Sec system translocase SecA2 433 45 textmining:431
Rv3354 hyp hypothetical protein 411 42 textmining:411
Rv3236c integral membrane transport protein 513 41 textmining:513

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
  • Pfam (hmmscan --cut_ga): Tad PF13400.12 (E=4e-08)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218171.2)
  • Domains: Pfam-A via hmmscan --cut_ga — Tad (PF13400.12)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2DRBM
  • Curated reference: UniProt O69622 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 11 functional partner(s); context anchor Rv3659c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv3654c|
MLAVAMVAVLLCVTGAGAYLGSAVVARHRAQAAADLASLAAAARLPSGLAAACARATLVARAMRVEHAQCRVVDLDVVVTVEVAVAFAGVATATARAGPAKVPTTPG