Rv3656c Still unknown · low auto-curated

H37Rv Rv3656c · MTBC0 mtbc0_003874 · 68 aa · 4119154–4119360 (-) · RefSeq NP_218173.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationDUF4244 domain-containing protein
Revised (this work)Conserved hypothetical protein; DUF domain(s) DUF4244. Function unknown.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O69624 TrEMBL · unreviewed · Predicted
UniProt nameDUF4244 domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionProtein of unknown function (DUF4244)
Orthologous group2EHCF

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.724 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF4244PF14029.12 3.6e-2313–65 Protein of unknown function (DUF4244)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv3657c (membrane protein), high confidence from genomic context alone (score 874 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3655c hyp hypothetical protein 900 900 ctx neighborhood:851
Rv3657c membrane protein 983 874 ctx neighborhood:835 textmining:870
Rv3659c conjugal transfer protein 982 859 ctx neighborhood:851 textmining:881
Rv3658c transmembrane protein 857 857 ctx neighborhood:851
Rv3654c hyp hypothetical protein 968 853 ctx neighborhood:851 textmining:796
Rv3660c ssd hyp hypothetical protein 950 758 ctx neighborhood:754 textmining:803
Rv0948c chorismate mutase 709 710 ctx cooccurence:708
Rv3605c hyp hypothetical protein 653 653 ctx cooccurence:653
Rv3793 embC arabinosyltransferase C 634 635 ctx cooccurence:633
Rv2179c 3'-5' exoribonuclease 625 625 ctx cooccurence:625
Rv2744c 35kd_ag hyp hypothetical protein 625 625 ctx cooccurence:624
Rv3795 embB arabinosyltransferase B 620 620 ctx cooccurence:620
Rv3794 embA arabinosyltransferase A 606 606 ctx cooccurence:606
Rv3231c hyp hypothetical protein 525 525 ctx cooccurence:522
Rv2927c sepIVA hyp hypothetical protein 516 517 ctx cooccurence:515

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: DUF4244 domain-containing protein
  • Pfam (hmmscan --cut_ga): DUF4244 PF14029.12 (E=4e-23)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218173.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF4244 (PF14029.12)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2EHCF
  • Curated reference: UniProt O69624 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 64.9, low)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 24 functional partner(s); context anchor Rv3657c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003874|Rv3656c|
MLVITMFRVLVARMTALAVDESGMSTVEYAIGTIAAAAFGAILYTVVTGDSIVSALNRIIGRALSTKV