sigF Resolved · high auto-curated

H37Rv Rv3286c · MTBC0 mtbc0_003494 · 261 aa · 3690249–3691034 (-) · RefSeq NP_217803.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)RNA polymerase sigma factor SigF
MTBC0 PGAP re-annotationRNA polymerase sigma factor SigF
Revised (this work)RNA polymerase sigma factor SigF. Pfam: Sigma70_r2 (PF04542.21), Sigma70_r3 (PF04539.23), Sigma70_r4_2 (PF08281.19), Sigma70_r4 (PF04545.23).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WGI3 SwissProt · reviewed · Evidence at protein level
UniProt nameRNA polymerase sigma factor SigF
Curated functionSigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. Held in an inactive form by a cognate anti-sigma factor RsbW (UsfX) until released. Increased expression decreases growth rate, and after 3 days increases the expression of 51 loci encoding 33 protein-coding genes as well as some non-coding RNA.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
Preferred namesigF
eggNOG descriptionSigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released
Orthologous groupCOG1191
KEGG orthology K03090
Gene Ontology (78) GO:0000988, GO:0000990, GO:0003674, GO:0005488, GO:0005515, GO:0006355, GO:0006629, GO:0006950, GO:0006979, GO:0006995, GO:0007154, GO:0008150 +66 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.354 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Sigma70_r2PF04542.21 5.6e-1443–112 Sigma-70 region 2
Sigma70_r3PF04539.23 7.9e-11126–188 Sigma-70 region 3
Sigma70_r4_2PF08281.19 2.0e-10206–256 Sigma-70, region 4
Sigma70_r4PF04545.23 3.7e-17209–257 Sigma-70, region 4

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rsbW (anti-sigma factor RsbW), high confidence from genomic context alone (score 989 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3287c rsbW anti-sigma factor RsbW 998 989 ctx neighborhood:802 cooccurence:407 coexpression:840 experimental:471 textmining:859
Rv1364c sigma factor regulatory protein 976 935 ctx neighborhood:544 coexpression:713 experimental:471 textmining:643
Rv0667 rpoB DNA-directed RNA polymerase subunit beta 937 919 experimental:904
Rv0668 rpoC DNA-directed RNA polymerase subunit beta' 931 911 experimental:897
Rv3288c usfY hyp hypothetical protein 805 805 ctx neighborhood:701
Rv3457c rpoA DNA-directed RNA polymerase subunit alpha 839 790 experimental:789
Rv1904 hyp hypothetical protein 715 595
Rv0516c oprA anti-anti-sigma factor 891 592 textmining:745
Rv3289c transmembrane protein 568 569 ctx neighborhood:462
Rv3660c ssd hyp hypothetical protein 545 505 coexpression:420
Rv1390 rpoZ DNA-directed RNA polymerase subunit omega 559 495 experimental:474
Rv2588c yajC membrane protein secretion factor YajC 488 489 experimental:458
Rv2785c rpsO 30S ribosomal protein S15 478 478 experimental:458
Rv1107c xseB exodeoxyribonuclease VII small subunit 461 461 experimental:458
Rv0714 rplN 50S ribosomal protein L14 460 461 experimental:458

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: RNA polymerase sigma factor SigF
  • MTBC0 PGAP product: RNA polymerase sigma factor SigF
  • Pfam (hmmscan --cut_ga): Sigma70_r2 PF04542.21 (E=6e-14), Sigma70_r3 PF04539.23 (E=8e-11), Sigma70_r4_2 PF08281.19 (E=2e-10), Sigma70_r4 PF04545.23 (E=4e-17)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217803.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Sigma70_r2 (PF04542.21), Sigma70_r3 (PF04539.23), Sigma70_r4_2 (PF08281.19), Sigma70_r4 (PF04545.23)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1191
  • Curated reference: UniProt P9WGI3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 63 functional partner(s); context anchor rsbW
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003494|Rv3286c|sigF
MTARAAGGSASRANEYADVPEMFRELVGLPAGSPEFQRHRDKIVQRCLPLADHIARRFEGRGEPRDDLIQVARVGLVNAAVRFDVKTGSDFVSFAVPTIMGEVRRHFRDNSWSVKVPRRLKELHLRLGTATADLSQRLGRAPSASELAAELGMDRAEVIEGLLAGSSYHTLSIDSGGGSDDDARAITDTLGDVDAGLDQIENREVLRPLLEALPERERTVLVLRFFDSMTQTQIAERVGISQMHVSRLLAKSLARLRDQLE