sigF Resolved · high auto-curated

H37Rv Rv3286c · MTBC0 mtbc0_003494 · 261 aa · 3690249–3691034 MTBC0 (-) · RefSeq NP_217803.1

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)RNA polymerase sigma factor SigF
MTBC0 PGAP re-annotationRNA polymerase sigma factor SigF
Revised (this work)RNA polymerase sigma factor SigF. Pfam: Sigma70_r2 (PF04542.21), Sigma70_r3 (PF04539.23), Sigma70_r4_2 (PF08281.19), Sigma70_r4 (PF04545.23).
Functional category (TubercuList)information pathways

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 59 publications

59 TB publications mention this gene. 59 publication(s) discuss this gene (46 in a M. tuberculosis context, 25 in other mycobacteria — M. smegmatis (23), M. marinum (2), M. abscessus (1)).

Most recent 5 of 59.
PublicationDate
Regulatory mechanism of the SenX3-RegX3 two-component system in Mycobacterium smegmatis: Roles of PhoU in sensing inorganic phosphate levels. doi:10.1016/j.jbc.2025.110435 2025
Molecular insight into thymoquinone mechanism of action against Mycobacterium tuberculosis. doi:10.3389/fmicb.2024.1353875 2024
The RsfSR two-component system regulates SigF function by monitoring the state of the respiratory electron transport chain in Mycobacterium smegmatis. doi:10.1016/j.jbc.2024.105764 2024
MSMEG_0311 is a conserved essential polar protein involved in mycobacterium cell wall metabolism. doi:10.1016/j.ijbiomac.2024.129583 2024
Mycobacterial Regulatory Systems Involved in the Regulation of Gene Expression Under Respiration-Inhibitory Conditions. doi:10.1007/s12275-023-00026-8 2023

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

Genomic-neighbour overlap (structural caveat) co-directional · 1 % of gene

NeighbourrsbW (Rv3287c, - strand)
Overlap4 bp, 1 % of this gene's length

co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.

CRISPRi vulnerability

Vulnerability index 1.08 (95% CI -1.02 to 4.40). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionThe sigma factor is an initiation factor that promotes attachment of the RNA polymerase to specific initiation sites and then is released. Thought to be involved in survival and proliferation in lung granulomas during infection. Thought to be involved in virulence and persistence processes. Modulates expression of the 16 KDa alpha-crystallin homologue/Rv2031c. Negatively regulated by Rv3287c|RSBW|

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb3314c · 99.6% identity
M. marinum MMAR_1248 · 88.5% identity
M. smegmatis MSMEG_1804 · 83.1% identity
M. orygis RJtmp_003386 · 99.6% identity
M. abscessus MAB_2511 · 55.6% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WGI3 SwissProt · reviewed · Evidence at protein level
UniProt nameRNA polymerase sigma factor SigF
Curated functionSigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. Held in an inactive form by a cognate anti-sigma factor RsbW (UsfX) until released. Increased expression decreases growth rate, and after 3 days increases the expression of 51 loci encoding 33 protein-coding genes as well as some non-coding RNA.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
Preferred namesigF
eggNOG descriptionSigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released
Orthologous groupCOG1191
KEGG orthology K03090
Gene Ontology (78) GO:0000988, GO:0000990, GO:0003674, GO:0005488, GO:0005515, GO:0006355, GO:0006629, GO:0006950, GO:0006979, GO:0006995, GO:0007154, GO:0008150 +66 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.354 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Bacteria

M. canettii dN/dS (deep-divergence selection) 0.0 (low power) · 1 consensus substitution(s)
low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 50/53 (94%) · mean identity 86.6% · 4/4 closest MTBAP relatives
conserved across the genus (present in 50/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 7/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 50.1%
detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callGA · growth-advantage
What the call meansgrowth-advantage: insertions enriched
TA sites (Himar1) 12 in the ORF — 0 in the essential state, 0 growth-defect, 0 non-essential, 12 growth-advantage. Saturation 1.000, mean read count 126.916666667. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) detected

MS detectiondetected in 10 of 16 independent MS datasets
Integrated abundance16.9 ppm · rank 2424/3519 (31.1th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length261 aa
Molecular weight28.8 kDa
Theoretical pI6.12
GRAVY-0.299 (hydrophilic)
Aliphatic index92.7
Aromaticity0.046
Instability index40.6 (unstable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Sigma70_r2PF04542.21 5.6e-1443–112 Sigma-70 region 2
Sigma70_r3PF04539.23 7.9e-11126–188 Sigma-70 region 3
Sigma70_r4_2PF08281.19 2.0e-10206–256 Sigma-70, region 4
Sigma70_r4PF04545.23 3.7e-17209–257 Sigma-70, region 4

Experimental structures (Protein Data Bank) 1 solved

PDBMethodResolutionCoverage
8jzt X-ray diffraction 1.94 Å 26%

Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (1 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 86.9

PDB hitprobTM-scoreE-valueDescription
5vi5-assembly1_F 1.00 0.56 2.7e-12 sig 5vi5-assembly1_F Structure of Mycobacterium smegmatis transcription initiation complex with a full transcription bubble
6ccv-assembly1_F 1.00 0.55 4.0e-12 sig 6ccv-assembly1_F Crystal structure of a Mycobacterium smegmatis RNA polymerase transcription initiation complex with inhibitor Rifampicin
5tw1-assembly1_F 1.00 0.55 4.0e-12 sig 5tw1-assembly1_F Crystal structure of a Mycobacterium smegmatis transcription initiation complex with RbpA
5vi8-assembly1_F 1.00 0.55 6.2e-12 sig 5vi8-assembly1_F Structure of a mycobacterium smegmatis transcription initiation complex with an upstream-fork promoter fragment
6dcf-assembly1_F 1.00 0.53 2.9e-12 sig 6dcf-assembly1_F Crystal structure of a Mycobacterium smegmatis transcription initiation complex with Rifampicin-resistant RNA polymerase and bound to kanglemycin A

Foldseek search of the AlphaFold DB model (mean pLDDT 86.9, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 2

Upstream (5' on genome)accA3 (+ strand, 9 bp gap)
Downstream (3' on genome)rsbW (- strand, -4 bp gap)
Predicted operon sigF · rsbW

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE) transcription factor

Regulated by (1 TF) sigF (activates)
Regulonthis transcription factor regulates 9 target gene(s)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: rsbW (anti-sigma factor RsbW), high confidence from genomic context alone (score 989 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3287c rsbW exp anti-sigma factor RsbW 998 989 ctx neighborhood:802 cooccurence:407 coexpression:840 experimental:471 textmining:859
Rv1364c exp sigma factor regulatory protein 976 935 ctx neighborhood:544 coexpression:713 experimental:471 textmining:643
Rv0667 rpoB exp DNA-directed RNA polymerase subunit beta 937 919 experimental:904
Rv0668 rpoC exp DNA-directed RNA polymerase subunit beta' 931 911 experimental:897
Rv3288c usfY hyp hypothetical protein 805 805 ctx neighborhood:701
Rv3457c rpoA exp DNA-directed RNA polymerase subunit alpha 839 790 experimental:789
Rv1904 hyp hypothetical protein 715 595
Rv0516c oprA anti-anti-sigma factor 891 592 textmining:745
Rv3289c transmembrane protein 568 569 ctx neighborhood:462
Rv3660c ssd hyp hypothetical protein 545 505 coexpression:420
Rv1390 rpoZ exp DNA-directed RNA polymerase subunit omega 559 495 experimental:474
Rv2588c yajC exp membrane protein secretion factor YajC 488 489 experimental:458
Rv2785c rpsO exp 30S ribosomal protein S15 478 478 experimental:458
Rv1107c xseB exp exodeoxyribonuclease VII small subunit 461 461 experimental:458
Rv0714 rplN exp 50S ribosomal protein L14 460 461 experimental:458

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: RNA polymerase sigma factor SigF
  • MTBC0 PGAP product: RNA polymerase sigma factor SigF
  • Pfam (hmmscan --cut_ga): Sigma70_r2 PF04542.21 (E=6e-14), Sigma70_r3 PF04539.23 (E=8e-11), Sigma70_r4_2 PF08281.19 (E=2e-10), Sigma70_r4 PF04545.23 (E=4e-17)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217803.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Sigma70_r2 (PF04542.21), Sigma70_r3 (PF04539.23), Sigma70_r4_2 (PF08281.19), Sigma70_r4 (PF04545.23)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1191
  • Curated reference: UniProt P9WGI3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 86.9)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 63 functional partner(s); context anchor rsbW
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003494|Rv3286c|sigF
MTARAAGGSASRANEYADVPEMFRELVGLPAGSPEFQRHRDKIVQRCLPLADHIARRFEGRGEPRDDLIQVARVGLVNAAVRFDVKTGSDFVSFAVPTIMGEVRRHFRDNSWSVKVPRRLKELHLRLGTATADLSQRLGRAPSASELAAELGMDRAEVIEGLLAGSSYHTLSIDSGGGSDDDARAITDTLGDVDAGLDQIENREVLRPLLEALPERERTVLVLRFFDSMTQTQIAERVGISQMHVSRLLAKSLARLRDQLE