Rv3658c Family assigned · medium auto-curated

H37Rv Rv3658c · MTBC0 mtbc0_003876 · 266 aa · 4119969–4120769 (-) · RefSeq NP_218175.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transmembrane protein
MTBC0 PGAP re-annotationtype II secretion system F family protein
Revised (this work)Type II secretion system F family protein. Pfam: T2SSF (PF00482.29).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6Y479 TrEMBL · unreviewed · Predicted
UniProt nameProbable conserved transmembrane protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category U Intracellular trafficking, secretion and vesicular transport
eggNOG descriptionFlp pilus assembly protein TadB
Orthologous groupCOG4965
KEGG orthology K12510

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.715 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 8 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
T2SSFPF00482.29 6.9e-0997–220 Type II secretion system (T2SS), protein F

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv3659c (conjugal transfer protein), high confidence from genomic context alone (score 948 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3659c conjugal transfer protein 954 948 ctx neighborhood:882 coexpression:579
Rv3657c membrane protein 933 933 ctx neighborhood:851 coexpression:415
Rv1364c sigma factor regulatory protein 919 920 coexpression:920
Rv3655c hyp hypothetical protein 921 912 ctx neighborhood:793 coexpression:593
Rv3660c ssd hyp hypothetical protein 875 871 ctx neighborhood:773
Rv3656c hyp hypothetical protein 857 857 ctx neighborhood:851
Rv3654c hyp hypothetical protein 827 827 ctx neighborhood:824
Rv0990c hyp hypothetical protein 812 788 coexpression:676
Rv3909 hyp hypothetical protein 769 769 ctx cooccurence:768
Rv2164c hyp hypothetical protein 748 749 ctx cooccurence:748
Rv1024 membrane protein 747 748 ctx cooccurence:746
Rv3835 hyp hypothetical protein 725 725 ctx cooccurence:722
Rv0007 membrane protein 715 705 ctx cooccurence:702
Rv1354c hyp hypothetical protein 669 669 coexpression:647
Rv1728c hyp hypothetical protein 656 656 ctx cooccurence:656

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: transmembrane protein
  • MTBC0 PGAP product: type II secretion system F family protein
  • Pfam (hmmscan --cut_ga): T2SSF PF00482.29 (E=7e-09)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218175.1)
  • Domains: Pfam-A via hmmscan --cut_ga — T2SSF (PF00482.29)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG4965
  • Curated reference: UniProt I6Y479 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 43 functional partner(s); context anchor Rv3659c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003876|Rv3658c|
MSGIASAALILSLALVVLPGSPRCRLTPDDTGRRVLLVGARRVAWGVGCVAVGVAALLPLPTVVAVAVLGATLGLRYRRRRRYLRRSREGQALEAALELVVGELRAGAHPVRAFSIAADETGGPVAVALRAVAARARLGADVTAGLLAAARSSALPAYWERLAVCWQLGSDHGLAIASLMRAAQRDVAERQRFSARVSAGMAGARASAAILAILPLLGVLLGQLIGARPLSFLLTGRVGGWLLVVGLTLACAGLLWSDRITDRPVL