Rv3657c Family assigned · medium auto-curated

H37Rv Rv3657c · MTBC0 - · 191 aa · 4095540–4096115 (-) · RefSeq NP_218174.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)membrane protein
MTBC0 PGAP re-annotation
Revised (this work)Membrane protein. Pfam: T2SSF (PF00482.29).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt O69625 TrEMBL · unreviewed · Predicted
UniProt namePossible conserved alanine rich membrane protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category N Cell motility
U Intracellular trafficking, secretion and vesicular transport
eggNOG descriptiontype II secretion system protein
Orthologous groupCOG2064
KEGG orthology K12510

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
T2SSFPF00482.29 6.0e-1446–173 Type II secretion system (T2SS), protein F

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv3659c (conjugal transfer protein), high confidence from genomic context alone (score 977 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3659c conjugal transfer protein 997 977 ctx neighborhood:851 coexpression:851 textmining:885
Rv3658c transmembrane protein 933 933 ctx neighborhood:851 coexpression:415
Rv1364c sigma factor regulatory protein 930 931 coexpression:920
Rv3660c ssd hyp hypothetical protein 980 903 ctx neighborhood:754 cooccurence:599 textmining:810
Rv3655c hyp hypothetical protein 889 877 ctx neighborhood:741 coexpression:545
Rv3656c hyp hypothetical protein 983 874 ctx neighborhood:835 textmining:870
Rv3654c hyp hypothetical protein 962 824 ctx neighborhood:813 textmining:796
Rv0990c hyp hypothetical protein 844 824 ctx cooccurence:450 coexpression:675
Rv3450c eccB4 ESX-4 secretion system protein EccB4 802 802 coexpression:736
Rv3231c hyp hypothetical protein 699 699 ctx cooccurence:691
Rv2170 GCN5-like N-acetyltransferase 676 676 ctx cooccurence:675
Rv1354c hyp hypothetical protein 672 672 coexpression:650
Rv2219 transmembrane protein 577 577 ctx cooccurence:575
Rv2239c hyp hypothetical protein 569 569 ctx cooccurence:568
Rv3287c rsbW anti-sigma factor RsbW 564 565 coexpression:412

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): membrane protein
  • Pfam (hmmscan --cut_ga): T2SSF PF00482.29 (E=6e-14)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218174.1)
  • Domains: Pfam-A via hmmscan --cut_ga — T2SSF (PF00482.29)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2064
  • Curated reference: UniProt O69625 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 42 functional partner(s); context anchor Rv3659c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv3657c|
MALWLGAGPSVVRARAGRPPRAHRPHQGLLLGRTDVADPLAVAASLDVLAVCLAAGMAVSTAAAATAAVAPPRLARVLRRAADLLALGADPNIAWSRPPDLPPGTHDAQTDAVLRLARRSAASGAALADGIVELAVQVRHDAAQAAAAAAERAGVLIAGPLGLCFLPAFLCVGIVPLVVGLAGDVLQFGLV