bpa Resolved · high auto-curated
H37Rv Rv3780 · MTBC0 mtbc0_004008 ·
178 aa ·
4251110–4251646 MTBC0
(+) ·
RefSeq NP_218297.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | proteasome activator protein Bpa |
| Revised (this work) | Proteasome activator protein Bpa. Pfam: BPA (PF10759.15). |
| Functional category (TubercuList) | conserved hypotheticals |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 3 publications
Found under: H37Rv (3).
3 TB publications mention this gene. 3 publication(s) mention this gene (title/abstract), verified against the text. The atlas states the function; these are the primary sources that discuss it.
| Publication | Date |
|---|---|
| Structural analysis of the dodecameric proteasome activator PafE in Mycobacterium tuberculosis. doi:10.1073/pnas.1512094113 | 2016 |
| An adenosine triphosphate-independent proteasome activator contributes to the virulence of Mycobacterium tuberculosis. doi:10.1073/pnas.1423319112 | 2015 |
| Bacterial proteasome activator bpa (rv3780) is a novel ring-shaped interactor of the mycobacterial proteasome. doi:10.1371/journal.pone.0114348 | 2014 |
This layer CITES the literature, it does not change the verdict or the function. A gene may be heavily studied (as an antigen, a resistance determinant, a drug target) while its molecular function is settled elsewhere in the fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole), MULTI-ALIAS sweep: H37Rv locus tag AND every ortholog identifier (M. bovis Mb…, M. marinum MMAR_…, M. smegmatis MSMEG_…, M. leprae ML…, M. abscessus MAB_…), each hit VERIFIED against the abstract text (word-boundary regex). phase73/phase75, 2026-07-13.
Intrinsic disorder (sequence + structure) partially disordered
| Predicted disorder | 35% of residues (metapredict) · mean AlphaFold pLDDT 82.1 |
|---|---|
| Disordered regions | 2 IDR(s), longest 40 aa [0-40, 156-178] |
carries a substantial disordered region (62/178 residues); disorder is a property, not a function
A property (biophysics), not a function. No LLPS/condensate claim is made from disorder alone. Verdict unchanged. Source: metapredict v3 (Emenecker/Holehouse) per-residue disorder + AlphaFold mean pLDDT (annotation_mtbc P16.13).
CRISPRi vulnerability
Vulnerability index -3.44 (95% CI -4.89 to -1.96). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser) ahead of Mycobrowser
| Mycobrowser function | Function unknown |
|---|
Mycobrowser classes this locus among conserved hypotheticals; the atlas now assigns a functional handle (curated function (UniProt), requalified function). Mycobrowser is no longer maintained, so its EC numbers predate recent nomenclature revisions (e.g. the 2018 EC 7 "translocase" class) — most EC differences are re-numberings of the same enzyme, not conflicts.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb3809
· 99.4% identity |
|---|---|
| M. leprae |
ML0115c
· 81.4% identity |
| M. marinum |
MMAR_5335
· 89.8% identity |
| M. smegmatis |
MSMEG_6365
· 74.3% identity |
| M. orygis |
RJtmp_003892
· 99.4% identity |
| M. abscessus |
MAB_0204c
· 78.3% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WKX3
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Bacterial proteasome activator |
| Curated function | Interacts with the core proteasome alpha-subunit (PrcA) through its C-terminal hydrophobic-tyrosine-X motif (HbYX motif). Interaction of Bpa with the proteasome stimulates proteasomal peptidase and casein degradation activity, which suggests Bpa could play a role in the removal of non-native or damaged proteins by influencing the conformation of the proteasome complex upon interaction. Can inhibit degradation of Pup-tagged substrates in vitro by competing with Mpa for association with the proteasome. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| Preferred name | bpa |
| eggNOG description | Interacts with the core proteasome alpha-subunit (PrcA) through its C-terminal hydrophobic-tyrosine-X motif (HbYX motif). Interaction of Bpa with the proteasome stimulates proteosomal peptidase and casein degradation activity, which suggests Bpa could play a role in the removal of non-native or damaged proteins by influencing the conformation of the proteasome complex upon interaction |
| Orthologous group | 291ZT |
| Gene Ontology (62) |
GO:0000502, GO:0003674, GO:0005488, GO:0005575, GO:0005618, GO:0005622, GO:0005623, GO:0005886, GO:0008150, GO:0009893, GO:0009894, GO:0009896 +50 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.33 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Actinomycetia
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 85.5%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
|---|---|
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 6/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 78.3% detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis) essential
| DeJesus 2017 call | ES · essential |
|---|---|
| What the call means | essential: insertions absent across the whole ORF |
| TA sites (Himar1) | 9 in the ORF — 8 in the essential state, 0 growth-defect, 0 non-essential, 1 growth-advantage. Saturation 0.333, mean read count 26. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | Read with some caution: only 9 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 9 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Chemical-genetic target & druggability (PROSPECT) hypomorph tool strain
This gene is part of the PROSPECT collection of TetON transcriptional-knockdown (hypomorph) strains of essential M. tuberculosis genes, built as a sensitised background for chemical-genetic mechanism-of-action deconvolution. Being in the panel means the gene is an essential / vulnerable target for which a validated knockdown tool strain exists.
| Hypomorph strain | Rv3780_TetOn1.1 (TetON promoter 1) |
|---|---|
| Baseline knockdown fitness | 3.321 median doublings (across 1 screen pool(s)) — fewer doublings = stronger growth defect on knockdown |
| Used in target deconvolution | no (Excluded - not in all screening waves) |
Panel membership reflects essentiality/vulnerability and the availability of a genetic tool, not a specific molecular function; it never changes the verdict here. Source: Bond AN et al., Nat Commun 2025;16:9673 (doi:10.1038/s41467-025-64662-x); PROSPECT chemical-genetic platform.
Proteomics (mass spectrometry) detected
| MS detection | detected in 16 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 489.0 ppm · rank 416/3519 (88.2th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 178 aa |
|---|---|
| Molecular weight | 19.5 kDa |
| Theoretical pI | 4.76 |
| GRAVY | -0.366 (hydrophilic) |
| Aliphatic index | 95.4 |
| Aromaticity | 0.028 |
| Instability index | 39.3 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
BPA | PF10759.15 | 7.6e-79 | 32–170 | Bacterial proteasome activator |
Experimental structures (Protein Data Bank) 9 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
8rgx |
Electron Microscopy | 3.2 Å | 100% |
6bgl |
Electron Microscopy | 3.4 Å | 100% |
6bgo |
Electron Microscopy | 4.2 Å | 100% |
5lzp |
Electron Microscopy | 3.5 Å | 99% |
5iet |
X-ray diffraction | 2.88 Å | 80% |
5lfp |
X-ray diffraction | 3.303 Å | 75% |
5lfj |
X-ray diffraction | 2.6 Å | 71% |
5lfq |
X-ray diffraction | 3.503 Å | 71% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (9 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 82.1
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
5lfj-assembly1_B-2 |
1.00 | 0.95 | 2.9e-15 sig | 5lfj-assembly1_B-2 Crystal Structure of the Bacterial Proteasome Activator Bpa of Mycobacterium tuberculosis |
5lfj-assembly1_B-3 |
1.00 | 0.95 | 2.9e-15 sig | 5lfj-assembly1_B-3 Crystal Structure of the Bacterial Proteasome Activator Bpa of Mycobacterium tuberculosis |
5lfp-assembly1_A |
1.00 | 0.97 | 2.1e-14 sig | 5lfp-assembly1_A Crystal Structure of the Bacterial Proteasome Activator Bpa of Mycobacterium tuberculosis (space group P6322, SeMet) |
5lfq-assembly1_C |
1.00 | 0.95 | 1.8e-14 sig | 5lfq-assembly1_C Crystal Structure of the Bacterial Proteasome Activator Bpa of Mycobacterium tuberculosis (space group P3) |
5lfj-assembly1_C |
1.00 | 0.97 | 5.1e-14 sig | 5lfj-assembly1_C Crystal Structure of the Bacterial Proteasome Activator Bpa of Mycobacterium tuberculosis |
Foldseek search of the AlphaFold DB model (mean pLDDT 82.1, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 5
| Upstream (5' on genome) | Rv3779 (+ strand, 3 bp gap) |
|---|---|
| Downstream (3' on genome) | rfbE (+ strand, 3 bp gap) |
| Predicted operon |
Rv3779 · Rv3780 · rfbE · glfT1 · rfbD
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (1 TF) |
phoP (represses)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: prcA (proteasome subunit alpha), high confidence from genomic context alone (score 976 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2109c prcA exp |
proteasome subunit alpha | 981 | 976 ctx | cooccurence:766 experimental:900 |
Rv2115c mpa exp |
proteasome-associated ATPase | 984 | 971 ctx | cooccurence:724 database:900 textmining:466 |
Rv2110c prcB exp |
proteasome subunit beta | 960 | 949 ctx | cooccurence:754 experimental:800 |
Rv3781 rfbE |
O-antigen/lipopolysaccharide ABC transporter ATP-binding protein RfbE | 964 | 884 ctx | neighborhood:882 textmining:703 |
Rv3782 glfT1 |
galactofuranosyl transferase GlfT | 943 | 884 ctx | neighborhood:882 textmining:533 |
Rv3783 rfbD |
O-antigen/lipopolysaccharide ABC transporter permease RfbD | 962 | 882 ctx | neighborhood:881 textmining:694 |
Rv3779 |
transmembrane protein | 897 | 882 ctx | neighborhood:881 |
Rv2097c pafA |
proteasome accessory factor PafA | 777 | 713 ctx | cooccurence:709 |
Rv2112c dop |
pup deamidase/depupylase | 786 | 687 ctx | cooccurence:685 |
Rv2111c pup |
ubiquitin-like protein Pup | 694 | 681 ctx | cooccurence:679 |
Rv3778c |
aminotransferase | 639 | 639 ctx | neighborhood:636 |
Rv0738 hyp |
hypothetical protein | 567 | 567 ctx | cooccurence:566 |
Rv3660c ssd hyp |
hypothetical protein | 539 | 539 ctx | cooccurence:539 |
Rv3221A rshA |
anti-sigma factor RshA | 538 | 539 ctx | cooccurence:536 |
Rv3784 |
dTDP-glucose 4,6-dehydratase | 473 | 473 ctx | neighborhood:471 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: proteasome activator protein Bpa
- Pfam (hmmscan --cut_ga): BPA PF10759.15 (E=8e-79)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218297.1)
- Domains: Pfam-A via hmmscan --cut_ga — BPA (PF10759.15)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
291ZT - Curated reference: UniProt P9WKX3 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 82.1)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
22 functional partner(s); context anchor
prcA - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_004008|Rv3780|bpa MRKRMVIGLSTGSDDDDVEVIGGVDPRLIAVQENDSDESSLTDLVEQPAKVMRIGTMIKQLLEEVRAAPLDEASRNRLRDIHATSIRELEDGLAPELREELDRLTLPFNEDAVPSDAELRIAQAQLVGWLEGLFHGIQTALFAQQMAARAQLQQMRQGALPPGVGKSGQHGHGTGQYL
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for bpa? Email the maintainer — the message is pre-filled with this gene's details.