Rv3249c Family assigned · medium auto-curated

H37Rv Rv3249c · MTBC0 mtbc0_003457 · 211 aa · 3651895–3652530 (-) · RefSeq NP_217766.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)TetR family transcriptional regulator
MTBC0 PGAP re-annotationTetR family transcriptional regulator
Revised (this work)TetR family transcriptional regulator. Pfam: TetR_N (PF00440.30), TetR_C_35 (PF18556.7).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O05892 SwissProt · reviewed · Evidence at protein level
UniProt nameHTH-type transcriptional regulator AlkX
Curated functionRepresses the expression of the alkB-rubAB operon, which encodes the alkane hydroxylase AlkB and the rubredoxins RubA and RubB. Acts by binding to the promoter region of the operon. In addition, EMSA analysis show that AlkX can bind to the promoter region of mmpS1 and mmpL3 and to the intragenic region of mmpL11, suggesting that it may participate in the regulatory network that controls the expression of MmpL lipid transporters.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
eggNOG descriptionTranscriptional regulator
Orthologous groupCOG1309

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.278 · purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 2 missense, 1 nonsense, 0 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.66% of strains (955) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
TetR_NPF00440.30 5.2e-0929–71 Bacterial regulatory proteins, tetR family
TetR_C_35PF18556.7 7.5e-3498–200 Bacterial Tetracyclin repressor, C-terminal domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: alkB (transmembrane alkane 1-monooxygenase AlkB), high confidence from genomic context alone (score 947 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3252c alkB transmembrane alkane 1-monooxygenase AlkB 947 947 ctx neighborhood:881 cooccurence:488
Rv3250c rubB rubredoxin RubB 922 910 ctx neighborhood:881
Rv3251c rubA rubredoxin RubA 864 865 ctx neighborhood:830
Rv3248c sahH adenosylhomocysteinase 774 774 ctx neighborhood:771
Rv0885 hyp hypothetical protein 715 715 ctx cooccurence:713
Rv3247c tmk thymidylate kinase 703 703 ctx neighborhood:703
Rv1065 hyp hypothetical protein 685 686 ctx cooccurence:683
Rv0464c hyp hypothetical protein 660 661 ctx cooccurence:653
Rv0283 eccB3 ESX-3 secretion system protein EccB3 606 606 ctx cooccurence:604
Rv3346c transmembrane protein 601 601 ctx cooccurence:601
Rv1274 lprB lipoprotein LprB 598 598 ctx cooccurence:594
Rv3035 hyp hypothetical protein 572 570 ctx cooccurence:570
Rv3253c cationic amino acid transport integral membrane protein 555 556 ctx neighborhood:553
Rv1476 membrane protein 549 549 ctx cooccurence:547
Rv1318c adenylate cyclase 545 546 ctx cooccurence:545

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: TetR family transcriptional regulator
  • MTBC0 PGAP product: TetR family transcriptional regulator
  • Pfam (hmmscan --cut_ga): TetR_N PF00440.30 (E=5e-09), TetR_C_35 PF18556.7 (E=8e-34)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217766.1)
  • Domains: Pfam-A via hmmscan --cut_ga — TetR_N (PF00440.30), TetR_C_35 (PF18556.7)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1309
  • Curated reference: UniProt O05892 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 40 functional partner(s); context anchor alkB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003457|Rv3249c|
MSTPSATVAPVKRIPYAEASRALLRDSVLDAMRDLLLTRDWSAITLSDVARAAGISRQTIYNEFGSRQGLAQGYALRLADRLVDNVHASLDANVGNFYEAFLQGFRSFFAESAADPLVISLLTGVAKPDLLQLITTDSAPIITRASARLAPAFTDTWVATTDNDANVLSRAIVRLCLSYVSMPPEADHDVAADLARLITPFAERHGVINVP