kmtR Resolved · high auto-curated

H37Rv Rv0827c · MTBC0 mtbc0_000876 · 130 aa · 923808–924200 (-) · RefSeq NP_215342.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)HTH-type transcriptional regulator KmtR
MTBC0 PGAP re-annotationNi(II)/Co(II)-sensing metalloregulatory transcriptional repressor KmtR
Revised (this work)Ni(II)/Co(II)-sensing metalloregulatory transcriptional repressor KmtR. Pfam: HTH_20 (PF12840.14), HTH_5 (PF01022.27), MarR_2 (PF12802.14), HTH_IclR (PF09339.17).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53838 SwissProt · reviewed · Evidence at protein level
UniProt nameHTH-type transcriptional regulator KmtR
Curated functionRepresses expression of Rv2025c and its own expression. Acts by binding to the promoter regions.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
Preferred namekmtR
eggNOG descriptionregulatory protein, arsR
Orthologous groupCOG0640
Gene Ontology (13) GO:0003674, GO:0003676, GO:0003677, GO:0005488, GO:0008150, GO:0010035, GO:0010038, GO:0010045, GO:0032025, GO:0042221, GO:0050896, GO:0097159 +1 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.024 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
HTH_20PF12840.14 1.2e-0925–74 Helix-turn-helix domain
HTH_5PF01022.27 2.6e-1327–72 Bacterial regulatory protein, arsR family
MarR_2PF12802.14 2.7e-0629–77 MarR family
HTH_IclRPF09339.17 6.0e-0538–74 IclR helix-turn-helix domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0830 (S-adenosylmethionine-dependent methyltransferase), medium confidence from genomic context alone (score 681 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2359 zur zinc uptake regulation protein 819 792 coexpression:785
Rv1267c embR transcriptional regulator EmbR 788 788 coexpression:788
Rv0117 oxyS oxidative stress response regulatory protein OxyS 788 780 coexpression:780
Rv0377 HTH-type transcriptional regulator 763 754 coexpression:754
Rv3082c virS HTH-type transcriptional regulator VirS 756 747 coexpression:744
Rv1931c transcriptional regulator 736 737 coexpression:737
Rv2488c LuxR family transcriptional regulator 742 733 coexpression:733
Rv1027c kdpE transcriptional regulator KdpE 741 732 coexpression:732
Rv0830 S-adenosylmethionine-dependent methyltransferase 681 681 ctx neighborhood:680
Rv0828c deaminase 675 675 ctx neighborhood:675
Rv3167c TetR family transcriptional regulator 584 557 coexpression:557
Rv2025c cation efflux system protein 912 539 textmining:817
Rv1674c transcriptional regulator 768 533 textmining:525
Rv2642 ArsR family transcriptional regulator 627 513 ctx cooccurence:484
Rv1725c hyp hypothetical protein 470 469 coexpression:463

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: HTH-type transcriptional regulator KmtR
  • MTBC0 PGAP product: Ni(II)/Co(II)-sensing metalloregulatory transcriptional repressor KmtR
  • Pfam (hmmscan --cut_ga): HTH_20 PF12840.14 (E=1e-09), HTH_5 PF01022.27 (E=3e-13), MarR_2 PF12802.14 (E=3e-06), HTH_IclR PF09339.17 (E=6e-05)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215342.1)
  • Domains: Pfam-A via hmmscan --cut_ga — HTH_20 (PF12840.14), HTH_5 (PF01022.27), MarR_2 (PF12802.14), HTH_IclR (PF09339.17)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0640
  • Curated reference: UniProt O53838 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 36 functional partner(s); context anchor Rv0830
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000876|Rv0827c|kmtR
MYADSGPDPLPDDQVCLVVEVFRMLADATRVQVLWSLADREMSVNELAEQVGKPAPSVSQHLAKLRMARLVRTRRDGTTIFYRLENEHVRQLVIDAVFNAEHAGPGIPRHHRAAGGLQSVAKASATKDVG