Rv3655c Resolved · medium auto-curated

H37Rv Rv3655c · MTBC0 mtbc0_003873 · 99 aa · 4118754–4119130 (-) · RefSeq NP_218172.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationapoptosis inhibitor
Revised (this work)Apoptosis inhibitor.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O69623 SwissProt · reviewed · Evidence at protein level
UniProt nameApoptosis inhibitor Rv3655c
Curated functionEffector protein that participates in the suppression of macrophage apoptosis by blocking the extrinsic pathway. Interferes with caspase-8 activation and binds to the host E3 ubiquitin-protein ligase RNF213, whose fusion partners have anti-apoptotic function.

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2EGB2
Gene Ontology (28) GO:0008150, GO:0010941, GO:0033668, GO:0035821, GO:0042981, GO:0043067, GO:0043069, GO:0044003, GO:0044068, GO:0044403, GO:0044419, GO:0044531 +16 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.1 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 1 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 95.96% of strains (139346) · reference-fixed

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv3658c (transmembrane protein), high confidence from genomic context alone (score 912 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3658c transmembrane protein 921 912 ctx neighborhood:793 coexpression:593
Rv3656c hyp hypothetical protein 900 900 ctx neighborhood:851
Rv3659c conjugal transfer protein 903 897 ctx neighborhood:795 coexpression:516
Rv3654c hyp hypothetical protein 886 886 ctx neighborhood:881
Rv3657c membrane protein 889 877 ctx neighborhood:741 coexpression:545
Rv1364c sigma factor regulatory protein 809 809 coexpression:806
Rv0990c hyp hypothetical protein 751 728 coexpression:706
Rv0412c glnX membrane protein 570 570 ctx cooccurence:570
Rv2446c integral membrane protein 542 542 ctx cooccurence:541
Rv3660c ssd hyp hypothetical protein 540 528 ctx neighborhood:521
Rv0948c chorismate mutase 503 504 ctx cooccurence:499
Rv0358 hyp hypothetical protein 500 501 ctx cooccurence:493
Rv1382 hyp hypothetical protein 475 476 ctx cooccurence:474
Rv1354c hyp hypothetical protein 496 464 coexpression:455
Rv1083 hyp hypothetical protein 461 461 ctx cooccurence:461

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: apoptosis inhibitor
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218172.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2EGB2
  • Curated reference: UniProt O69623 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 25 functional partner(s); context anchor Rv3658c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003873|Rv3655c|
MEAALAIATLVLVLVLCLAGVTAVSMQVRCIDAAREAARLAARGDVRSATDVARSIAPRAALVQVHRDGEFVVATVTAHSNLLPTLDIAARAISVAEPG