Rv1211 Family assigned · medium

H37Rv Rv1211 · MTBC0 - · 75 aa · 1354243–1354470 (+) · RefSeq NP_215727.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Natively unfolded (intrinsically disordered) protein required for growth and pathogenesis; binds the calmodulin antagonist trifluoperazine (Kd 41 uM) in its C-terminal region while remaining unfolded. An earlier 'calmodulin-like Ca2+-binding protein (CAMLP)' assignment is CONTESTED: the structural study shows it does not bind Ca2+. A drug-interaction target of unfixed molecular function.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt O05312 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved protein

UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionProtein of unknown function (DUF3117)
Orthologous group2E39N

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF3117PF11314.14 2.5e-2824–73 Protein of unknown function (DUF3117)

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 69.1 (low). Low-confidence model: the fold may be unreliable, so treat these structural hits with caution.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
1gut-assembly1_C 0.98 0.70 2.5e-01 1gut-assembly1_C MopII from Clostridium pasteurianum (apo2)
5inw-assembly2_B 0.92 0.60 2.2e-01 5inw-assembly2_B Structure of reaction loop cleaved lamprey angiotensinogen
1h9m-assembly1_A 0.90 0.69 7.1e-01 1h9m-assembly1_A Two crystal structures of the cytoplasmic molybdate-binding protein ModG suggest a novel cooperative binding mechanism and provide insights into ligand-binding specificity. PEG-grown form with molybdate bound
7xt7-assembly1_k 0.90 0.66 4.6e-01 7xt7-assembly1_k RNA polymerase II elongation complex transcribing a nucleosome (EC49B)
1o7l-assembly1_B 0.87 0.73 7.5e-01 1o7l-assembly1_B Molybdate-activated form of ModE from Escherichia coli
5inw-assembly1_A 0.87 0.61 3.6e-01 5inw-assembly1_A Structure of reaction loop cleaved lamprey angiotensinogen
1o7l-assembly2_D 0.85 0.68 6.7e-01 1o7l-assembly2_D Molybdate-activated form of ModE from Escherichia coli
8f2u-assembly1_E 0.84 0.52 2.8e-01 8f2u-assembly1_E Human CCC complex

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: tagA (DNA-3-methyladenine glycosylase I TagA), high confidence from genomic context alone (score 756 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3678A hyp hypothetical protein 773 773 ctx cooccurence:770
Rv1209 hyp hypothetical protein 757 757 ctx neighborhood:754
Rv1210 tagA DNA-3-methyladenine glycosylase I TagA 949 756 ctx neighborhood:755 textmining:803
Rv1691 hyp hypothetical protein 637 637 ctx cooccurence:637
Rv1208 gpgS glucosyl-3-phosphoglycerate synthase 552 551 ctx neighborhood:549
Rv1207 folP2 dihydropteroate synthase 551 550 ctx neighborhood:549
Rv0883c sepH hyp hypothetical protein 501 501
Rv3660c ssd hyp hypothetical protein 459 459 ctx cooccurence:459
Rv3245c mtrB two component sensory histidine kinase MtrB 425 426 ctx cooccurence:422
Rv1205 log hyp hypothetical protein 409 409 ctx neighborhood:407
Rv3597c lsr2 iron-regulated H-NS-like protein 408 409
Rv1625c cya adenylate cyclase 441 50 textmining:436
Rv1264 adenylyl cyclase 517 47 textmining:514
Rv3645 transmembrane protein 440 47 textmining:437
Rv1832 gcvB glycine dehydrogenase 439 47 textmining:436

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Natively unfolded protein (size-exclusion, CD, NMR); binds trifluoperazine, NOT Ca2+ (Choo 2022, PMID 35468422)
  • Earlier calmodulin-like/EF-hand claim contested (Koul 2009, PMID 19639701)
  • Pfam DUF3117; required for growth
  • Curated from the literature crible (project 'Still unknown gene function', 2026-06-09)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215727.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF3117 (PF11314.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2E39N
  • Curated reference: UniProt O05312 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 69.1, low)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 21 functional partner(s); context anchor tagA
  • Primary literature: Choo M, Oh S, Jo S, Jin X, Song Y, Wen H, Park S, Kang S (2022). Highly conserved protein Rv1211 in Mycobacterium tuberculosis is a natively unfolded protein that binds to a calmodulin antagonist, trifluoperazine Biochem Biophys Res Commun 610:182-187. doi:10.1016/j.bbrc.2022.04.045 PMID:35468422
  • Primary literature: Koul S, Somayajulu A, Advani MJ, Reddy H (2009). A novel calcium binding protein in Mycobacterium tuberculosis - potential target for trifluoperazine Indian J Exp Biol 47(6):480-8. PMID:19639701

Ancestral MTBC0 protein sequence

>H37Rv|Rv1211|
MLGADQARAGGPARIWREHSMAAMKPRTGDGPLEATKEGRGIVMRVPLEGGGRLVVELTPDEAAALGDELKGVTS