Rv3289c Still unknown · low auto-curated
H37Rv Rv3289c · MTBC0 mtbc0_003497 ·
125 aa · 3692114–3692491 (-) ·
RefSeq NP_217806.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | transmembrane protein |
|---|---|
| MTBC0 PGAP re-annotation | hypothetical protein |
| Revised (this work) | Conserved hypothetical protein; no recognised domain. Function unknown. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P96894
TrEMBL · unreviewed
· Predicted
|
|---|---|
| UniProt name | Possible transmembrane protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| Orthologous group | 2B69G |
|---|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.147 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 5 synonymous, 2 missense, 0 nonsense, 1 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.21% of strains (312) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: lat (L-lysine-epsilon aminotransferase), high confidence from genomic context alone (score 976 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3290c lat |
L-lysine-epsilon aminotransferase | 975 | 976 ctx | neighborhood:835 coexpression:860 |
Rv3288c usfY hyp |
hypothetical protein | 967 | 968 ctx | neighborhood:817 coexpression:831 |
Rv3291c lrpA |
transcriptional regulator LrpA | 788 | 788 ctx | neighborhood:778 |
Rv3293 pcd |
piperideine-6-carboxylic acid dehydrogenase | 663 | 663 ctx | neighborhood:647 |
Rv3286c sigF |
RNA polymerase sigma factor SigF | 568 | 569 ctx | neighborhood:462 |
Rv3292 hyp |
hypothetical protein | 539 | 539 ctx | neighborhood:516 |
Rv3287c rsbW |
anti-sigma factor RsbW | 430 | 431 | |
Rv1004c |
membrane protein | 804 | 50 | textmining:803 |
Rv2138 lppL |
lipoprotein LppL | 554 | 50 | textmining:550 |
Rv0996 |
transmembrane protein | 753 | 49 | textmining:751 |
Rv2274c mazF8 |
toxin MazF8 | 629 | 41 | textmining:629 |
Rv1040c PE8 |
PE family protein PE8 | 515 | 41 | textmining:515 |
Rv2396 PE_PGRS41 |
acid and phagosome regulated protein AprC | 438 | 41 | textmining:438 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: transmembrane protein
- MTBC0 PGAP product: hypothetical protein
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217806.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2B69G - Curated reference: UniProt P96894 (TrEMBL, unreviewed; Predicted)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
13 functional partner(s); context anchor
lat - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003497|Rv3289c| MHEVGGPSRGDRLGRDDSEVHSAIRFAVVAAVVGVGFLIMGALLVSTCSGVDTAACGPPQRILLALGGPLILCAAGLWAFLRTYRVWRAEGTWWGWHGAGWFLLTLMVLTLCIGVPPIAGPVMAP