Rv3284 Family assigned · medium auto-curated

H37Rv Rv3284 · MTBC0 mtbc0_003492 · 143 aa · 3687898–3688329 (+) · RefSeq NP_217801.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationSufE family protein
Revised (this work)SufE family protein. Pfam: SufE (PF02657.21).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WGC3 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized SufE-like protein Rv3284

UniProt still lists this protein as Uncharacterized SufE-like protein Rv3284; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred namesufE
eggNOG descriptionFe-S metabolism associated
Orthologous groupCOG2166
KEGG orthology K02426

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.18 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 1 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.20% of strains (286) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
SufEPF02657.21 2.0e-2916–137 Fe-S metabolism associated domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: sseA (thiosulfate sulfurtransferase SseA), high confidence from genomic context alone (score 957 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3283 sseA thiosulfate sulfurtransferase SseA 957 957 ctx neighborhood:882 cooccurence:632
Rv3282 hyp hypothetical protein 826 826 ctx neighborhood:822
Rv3280 accD5 propionyl-CoA carboxylase subunit beta 824 825 ctx neighborhood:822
Rv3281 accE5 bifunctional protein acetyl-/propionyl-CoAcarboxylase subunit epsilon AccE 824 825 ctx neighborhood:822
Rv3285 accA3 bifunctional protein acetyl-/propionyl-CoA carboxylase subunit alpha AccA 771 771 ctx neighborhood:768
Rv3778c aminotransferase 701 670 experimental:490
Rv1464 csd cysteine desulfurase 701 670 experimental:490
Rv3700c egtE pyridoxal-phosphate-dependent protein EgtE 700 669 experimental:490
Rv1463 sufC ABC transporter ATP-binding protein 641 627 coexpression:421
Rv3279c birA bifunctional biotin operon repressor/biotin--[acetyl-CoA-carboxylase 569 569 ctx neighborhood:568
Rv1462 sufD hyp hypothetical protein 538 515
Rv3278c transmembrane protein 475 475 ctx neighborhood:474
Rv1461 sufB hyp hypothetical protein 475 450
Rv2475c hyp hypothetical protein 422 422 ctx cooccurence:413

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: SufE family protein
  • Pfam (hmmscan --cut_ga): SufE PF02657.21 (E=2e-29)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217801.1)
  • Domains: Pfam-A via hmmscan --cut_ga — SufE (PF02657.21)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2166
  • Curated reference: UniProt P9WGC3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 14 functional partner(s); context anchor sseA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003492|Rv3284|
MTAPASLPAPLAEVVSDFAEVQGQDKLRLLLEFANELPALPSHLAESAMEPVPECQSPLFLHVDASDPNRVRLHFSAPAEAPTTRGFASILAAGLDEQPAADILAVPEDFYTELGLAALISPLRLRGMSAMLARIKRRLREAD