Rv3284 Family assigned · medium auto-curated
H37Rv Rv3284 · MTBC0 mtbc0_003492 ·
143 aa · 3687898–3688329 (+) ·
RefSeq NP_217801.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | SufE family protein |
| Revised (this work) | SufE family protein. Pfam: SufE (PF02657.21). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WGC3
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Uncharacterized SufE-like protein Rv3284 |
UniProt still lists this protein as Uncharacterized SufE-like protein Rv3284; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| Preferred name | sufE |
| eggNOG description | Fe-S metabolism associated |
| Orthologous group | COG2166 |
| KEGG orthology |
K02426
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.18 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 1 missense, 0 nonsense, 1 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.20% of strains (286) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
SufE | PF02657.21 | 2.0e-29 | 16–137 | Fe-S metabolism associated domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: sseA (thiosulfate sulfurtransferase SseA), high confidence from genomic context alone (score 957 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3283 sseA |
thiosulfate sulfurtransferase SseA | 957 | 957 ctx | neighborhood:882 cooccurence:632 |
Rv3282 hyp |
hypothetical protein | 826 | 826 ctx | neighborhood:822 |
Rv3280 accD5 |
propionyl-CoA carboxylase subunit beta | 824 | 825 ctx | neighborhood:822 |
Rv3281 accE5 |
bifunctional protein acetyl-/propionyl-CoAcarboxylase subunit epsilon AccE | 824 | 825 ctx | neighborhood:822 |
Rv3285 accA3 |
bifunctional protein acetyl-/propionyl-CoA carboxylase subunit alpha AccA | 771 | 771 ctx | neighborhood:768 |
Rv3778c |
aminotransferase | 701 | 670 | experimental:490 |
Rv1464 csd |
cysteine desulfurase | 701 | 670 | experimental:490 |
Rv3700c egtE |
pyridoxal-phosphate-dependent protein EgtE | 700 | 669 | experimental:490 |
Rv1463 sufC |
ABC transporter ATP-binding protein | 641 | 627 | coexpression:421 |
Rv3279c birA |
bifunctional biotin operon repressor/biotin--[acetyl-CoA-carboxylase | 569 | 569 ctx | neighborhood:568 |
Rv1462 sufD hyp |
hypothetical protein | 538 | 515 | |
Rv3278c |
transmembrane protein | 475 | 475 ctx | neighborhood:474 |
Rv1461 sufB hyp |
hypothetical protein | 475 | 450 | |
Rv2475c hyp |
hypothetical protein | 422 | 422 ctx | cooccurence:413 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: SufE family protein
- Pfam (hmmscan --cut_ga): SufE PF02657.21 (E=2e-29)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217801.1)
- Domains: Pfam-A via hmmscan --cut_ga — SufE (PF02657.21)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2166 - Curated reference: UniProt P9WGC3 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
14 functional partner(s); context anchor
sseA - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003492|Rv3284| MTAPASLPAPLAEVVSDFAEVQGQDKLRLLLEFANELPALPSHLAESAMEPVPECQSPLFLHVDASDPNRVRLHFSAPAEAPTTRGFASILAAGLDEQPAADILAVPEDFYTELGLAALISPLRLRGMSAMLARIKRRLREAD