Rv0996 Family assigned · medium auto-curated
H37Rv Rv0996 · MTBC0 mtbc0_001067 ·
358 aa · 1119720–1120796 (+) ·
RefSeq NP_215511.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | transmembrane protein |
|---|---|
| MTBC0 PGAP re-annotation | hypothetical protein |
| Revised (this work) | Contains GlpR (PF28211.1) domain(s); putative function inferred from the domain architecture. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O05579
TrEMBL · unreviewed
· Predicted
|
|---|---|
| UniProt name | Probable conserved transmembrane protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| Orthologous group | 2EA6G |
|---|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.926 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 4 synonymous, 11 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
GlpR | PF28211.1 | 2.3e-93 | 5–338 | Gephyrin-like molybdotransferase receptor GlpR |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: moeA1 (molybdopterin molybdenumtransferase 1), high confidence from genomic context alone (score 773 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3212 hyp |
hypothetical protein | 773 | 773 ctx | cooccurence:772 |
Rv0994 moeA1 |
molybdopterin molybdenumtransferase 1 | 773 | 773 ctx | neighborhood:700 |
Rv0556 |
transmembrane protein | 772 | 773 ctx | cooccurence:772 |
Rv3438 hyp |
hypothetical protein | 770 | 770 ctx | cooccurence:770 |
Rv0475 hbhA |
heparin binding hemagglutinin HbhA | 770 | 770 ctx | cooccurence:767 |
Rv0383c ttfA hyp |
hypothetical protein | 770 | 770 ctx | cooccurence:770 |
Rv0358 hyp |
hypothetical protein | 768 | 769 ctx | cooccurence:768 |
Rv0481c hyp |
hypothetical protein | 767 | 768 ctx | cooccurence:767 |
Rv2138 lppL |
lipoprotein LppL | 883 | 767 ctx | cooccurence:766 textmining:519 |
Rv2446c |
integral membrane protein | 766 | 767 ctx | cooccurence:766 |
Rv3311 hyp |
hypothetical protein | 765 | 765 ctx | cooccurence:763 |
Rv3850 hyp |
hypothetical protein | 763 | 764 ctx | cooccurence:763 |
Rv1109c hyp |
hypothetical protein | 763 | 763 ctx | cooccurence:762 |
Rv2732c |
transmembrane protein | 760 | 761 ctx | cooccurence:759 |
Rv0497 |
transmembrane protein | 760 | 761 ctx | cooccurence:758 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: transmembrane protein
- MTBC0 PGAP product: hypothetical protein
- Pfam (hmmscan --cut_ga): GlpR PF28211.1 (E=2e-93)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215511.1)
- Domains: Pfam-A via hmmscan --cut_ga — GlpR (PF28211.1)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2EA6G - Curated reference: UniProt O05579 (TrEMBL, unreviewed; Predicted)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
160 functional partner(s); context anchor
moeA1 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001067|Rv0996| MPSIPQSLLWISLVVLWLFVLVPMLISKRDAVRRTSDVALATRVLNGGAGARLLKRGGPAAGHRWGYLPPEGQGDDPDWKPEEDWRDDPVEDGFADVEHDIDEDQEADDARRRGAVVMKVAAPQTAGADEPDYLDVDVVEEDSEALPVGAGAAVGESADEADAEAADGVAGHADPEADPVEYEYEYEYVEDTCGLELEEDDQEAPPTVASGTSRRRRFDTKTAAAVSARKYTFRKRALIVMAVILVGSAAAAFELTPVAWWICGSATGVTVLYLAYLRRQTRIEEKVRRRRMQRIARARLGVQNTRDREYDVVPSRLRRPGAVVLEIDDEDPIFTHLESAAPIRNYGWPRDLPRAVGQ