Rv0996 Family assigned · medium auto-curated

H37Rv Rv0996 · MTBC0 mtbc0_001067 · 358 aa · 1119720–1120796 (+) · RefSeq NP_215511.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transmembrane protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Contains GlpR (PF28211.1) domain(s); putative function inferred from the domain architecture.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O05579 TrEMBL · unreviewed · Predicted
UniProt nameProbable conserved transmembrane protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2EA6G

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.926 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 11 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
GlpRPF28211.1 2.3e-935–338 Gephyrin-like molybdotransferase receptor GlpR

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: moeA1 (molybdopterin molybdenumtransferase 1), high confidence from genomic context alone (score 773 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3212 hyp hypothetical protein 773 773 ctx cooccurence:772
Rv0994 moeA1 molybdopterin molybdenumtransferase 1 773 773 ctx neighborhood:700
Rv0556 transmembrane protein 772 773 ctx cooccurence:772
Rv3438 hyp hypothetical protein 770 770 ctx cooccurence:770
Rv0475 hbhA heparin binding hemagglutinin HbhA 770 770 ctx cooccurence:767
Rv0383c ttfA hyp hypothetical protein 770 770 ctx cooccurence:770
Rv0358 hyp hypothetical protein 768 769 ctx cooccurence:768
Rv0481c hyp hypothetical protein 767 768 ctx cooccurence:767
Rv2138 lppL lipoprotein LppL 883 767 ctx cooccurence:766 textmining:519
Rv2446c integral membrane protein 766 767 ctx cooccurence:766
Rv3311 hyp hypothetical protein 765 765 ctx cooccurence:763
Rv3850 hyp hypothetical protein 763 764 ctx cooccurence:763
Rv1109c hyp hypothetical protein 763 763 ctx cooccurence:762
Rv2732c transmembrane protein 760 761 ctx cooccurence:759
Rv0497 transmembrane protein 760 761 ctx cooccurence:758

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: transmembrane protein
  • MTBC0 PGAP product: hypothetical protein
  • Pfam (hmmscan --cut_ga): GlpR PF28211.1 (E=2e-93)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215511.1)
  • Domains: Pfam-A via hmmscan --cut_ga — GlpR (PF28211.1)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2EA6G
  • Curated reference: UniProt O05579 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 160 functional partner(s); context anchor moeA1
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001067|Rv0996|
MPSIPQSLLWISLVVLWLFVLVPMLISKRDAVRRTSDVALATRVLNGGAGARLLKRGGPAAGHRWGYLPPEGQGDDPDWKPEEDWRDDPVEDGFADVEHDIDEDQEADDARRRGAVVMKVAAPQTAGADEPDYLDVDVVEEDSEALPVGAGAAVGESADEADAEAADGVAGHADPEADPVEYEYEYEYVEDTCGLELEEDDQEAPPTVASGTSRRRRFDTKTAAAVSARKYTFRKRALIVMAVILVGSAAAAFELTPVAWWICGSATGVTVLYLAYLRRQTRIEEKVRRRRMQRIARARLGVQNTRDREYDVVPSRLRRPGAVVLEIDDEDPIFTHLESAAPIRNYGWPRDLPRAVGQ