Rv3282 Resolved · high auto-curated
H37Rv Rv3282 · MTBC0 mtbc0_003490 ·
222 aa · 3686299–3686967 (+) ·
RefSeq NP_217799.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | nucleoside triphosphate pyrophosphatase |
| Revised (this work) | Nucleoside triphosphate pyrophosphatase. Pfam: Maf (PF02545.20). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WK27
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Nucleoside triphosphate pyrophosphatase |
| EC (curated) |
EC 3.6.1.9
|
| Curated function | Nucleoside triphosphate pyrophosphatase. May have a dual role in cell division arrest and in preventing the incorporation of modified nucleotides into cellular nucleic acids. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
D Cell cycle control, cell division, chromosome partitioning
|
|---|---|
| Preferred name | maf |
| eggNOG description | Maf-like protein |
| Orthologous group | COG0424 |
| KEGG orthology |
K06287
|
| Gene Ontology (6) |
GO:0005575, GO:0005618, GO:0005623, GO:0030312, GO:0044464, GO:0071944
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 1.121 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 9 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Maf | PF02545.20 | 4.0e-45 | 3–201 | Maf-like protein |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: accD5 (propionyl-CoA carboxylase subunit beta), high confidence from genomic context alone (score 898 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3280 accD5 |
propionyl-CoA carboxylase subunit beta | 951 | 898 ctx | neighborhood:881 textmining:539 |
Rv3281 accE5 |
bifunctional protein acetyl-/propionyl-CoAcarboxylase subunit epsilon AccE | 958 | 884 ctx | neighborhood:882 textmining:653 |
Rv3284 hyp |
hypothetical protein | 826 | 826 ctx | neighborhood:822 |
Rv3283 sseA |
thiosulfate sulfurtransferase SseA | 830 | 823 ctx | neighborhood:822 |
Rv0413 mutT3 |
8-oxo-dGTP diphosphatase | 823 | 823 ctx | fusion:809 |
Rv0823c dusB |
tRNA-dihydrouridine synthase | 776 | 776 ctx | cooccurence:745 |
Rv3279c birA |
bifunctional biotin operon repressor/biotin--[acetyl-CoA-carboxylase | 774 | 775 ctx | neighborhood:766 |
Rv3278c |
transmembrane protein | 749 | 749 ctx | neighborhood:748 |
Rv3285 accA3 |
bifunctional protein acetyl-/propionyl-CoA carboxylase subunit alpha AccA | 599 | 600 ctx | neighborhood:597 |
Rv2444c rne |
ribonuclease E | 519 | 519 | |
Rv1614 lgt |
prolipoprotein diacylglyceryl transferase | 456 | 457 | coexpression:438 |
Rv1631 coaE |
dephospho-CoA kinase CoaE | 546 | 456 | |
Rv1390 rpoZ |
DNA-directed RNA polymerase subunit omega | 409 | 410 | coexpression:409 |
Rv2524c fas |
fatty acid synthase | 481 | 320 | |
Rv3462c infA |
translation initiation factor IF-1 | 527 | 287 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: nucleoside triphosphate pyrophosphatase
- Pfam (hmmscan --cut_ga): Maf PF02545.20 (E=4e-45)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217799.1)
- Domains: Pfam-A via hmmscan --cut_ga — Maf (PF02545.20)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0424 - Curated reference: UniProt P9WK27 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
28 functional partner(s); context anchor
accD5 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003490|Rv3282| MTRLVLGSASPGRLKVLRDAGIEPLVIASHVDEDVVIAALGPDAVPSDVVCVLAAAKAAQVATTLTGTQRIVAADCVVVACDSMLYIEGRLLGKPASIDEAREQWRSMAGRAGQLYTGHGVIRLQDNKTVYRAAETAITTVYFGTPSASDLEAYLASGESLRVAGGFTLDGLGGWFIDGVQGNPSNVIGLSLPLLRSLVQRCGLSVAALWAGNAGGPAHKQQ