Rv3282 Resolved · high auto-curated

H37Rv Rv3282 · MTBC0 mtbc0_003490 · 222 aa · 3686299–3686967 (+) · RefSeq NP_217799.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationnucleoside triphosphate pyrophosphatase
Revised (this work)Nucleoside triphosphate pyrophosphatase. Pfam: Maf (PF02545.20).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WK27 SwissProt · reviewed · Evidence at protein level
UniProt nameNucleoside triphosphate pyrophosphatase
EC (curated) EC 3.6.1.9
Curated functionNucleoside triphosphate pyrophosphatase. May have a dual role in cell division arrest and in preventing the incorporation of modified nucleotides into cellular nucleic acids.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category D Cell cycle control, cell division, chromosome partitioning
Preferred namemaf
eggNOG descriptionMaf-like protein
Orthologous groupCOG0424
KEGG orthology K06287
Gene Ontology (6) GO:0005575, GO:0005618, GO:0005623, GO:0030312, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.121 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 9 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
MafPF02545.20 4.0e-453–201 Maf-like protein

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: accD5 (propionyl-CoA carboxylase subunit beta), high confidence from genomic context alone (score 898 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3280 accD5 propionyl-CoA carboxylase subunit beta 951 898 ctx neighborhood:881 textmining:539
Rv3281 accE5 bifunctional protein acetyl-/propionyl-CoAcarboxylase subunit epsilon AccE 958 884 ctx neighborhood:882 textmining:653
Rv3284 hyp hypothetical protein 826 826 ctx neighborhood:822
Rv3283 sseA thiosulfate sulfurtransferase SseA 830 823 ctx neighborhood:822
Rv0413 mutT3 8-oxo-dGTP diphosphatase 823 823 ctx fusion:809
Rv0823c dusB tRNA-dihydrouridine synthase 776 776 ctx cooccurence:745
Rv3279c birA bifunctional biotin operon repressor/biotin--[acetyl-CoA-carboxylase 774 775 ctx neighborhood:766
Rv3278c transmembrane protein 749 749 ctx neighborhood:748
Rv3285 accA3 bifunctional protein acetyl-/propionyl-CoA carboxylase subunit alpha AccA 599 600 ctx neighborhood:597
Rv2444c rne ribonuclease E 519 519
Rv1614 lgt prolipoprotein diacylglyceryl transferase 456 457 coexpression:438
Rv1631 coaE dephospho-CoA kinase CoaE 546 456
Rv1390 rpoZ DNA-directed RNA polymerase subunit omega 409 410 coexpression:409
Rv2524c fas fatty acid synthase 481 320
Rv3462c infA translation initiation factor IF-1 527 287

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: nucleoside triphosphate pyrophosphatase
  • Pfam (hmmscan --cut_ga): Maf PF02545.20 (E=4e-45)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217799.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Maf (PF02545.20)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0424
  • Curated reference: UniProt P9WK27 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 28 functional partner(s); context anchor accD5
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003490|Rv3282|
MTRLVLGSASPGRLKVLRDAGIEPLVIASHVDEDVVIAALGPDAVPSDVVCVLAAAKAAQVATTLTGTQRIVAADCVVVACDSMLYIEGRLLGKPASIDEAREQWRSMAGRAGQLYTGHGVIRLQDNKTVYRAAETAITTVYFGTPSASDLEAYLASGESLRVAGGFTLDGLGGWFIDGVQGNPSNVIGLSLPLLRSLVQRCGLSVAALWAGNAGGPAHKQQ