purE Resolved · high auto-curated

H37Rv Rv3275c · MTBC0 mtbc0_003483 · 174 aa · 3680257–3680781 (-) · RefSeq NP_217792.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)5-(carboxyamino)imidazole ribonucleotide mutase
MTBC0 PGAP re-annotation5-(carboxyamino)imidazole ribonucleotide mutase
Revised (this work)5-(carboxyamino)imidazole ribonucleotide mutase. Pfam: AIRC (PF00731.27).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WHM1 SwissProt · reviewed · Evidence at protein level
UniProt nameN5-carboxyaminoimidazole ribonucleotide mutase
EC (curated) EC 5.4.99.18
Curated functionCatalyzes the conversion of N5-carboxyaminoimidazole ribonucleotide (N5-CAIR) to 4-carboxy-5-aminoimidazole ribonucleotide (CAIR).

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category F Nucleotide transport and metabolism
Preferred namepurE
eggNOG descriptionCatalyzes the conversion of N5-carboxyaminoimidazole ribonucleotide (N5-CAIR) to 4-carboxy-5-aminoimidazole ribonucleotide (CAIR)
Orthologous groupCOG0041
EC number EC 5.4.99.18
KEGG orthology K01588
KEGG pathways map00230, map01100, map01110, map01130
KEGG modules M00048
Gene Ontology (2) GO:0008150, GO:0040007

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.231 · purifying
Polymorphic sites (≥ 0.1% of strains) 5 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
AIRCPF00731.27 1.6e-649–153 AIR carboxylase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: purK (5-(carboxyamino)imidazole ribonucleotide synthase), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3276c purK 5-(carboxyamino)imidazole ribonucleotide synthase 999 1000 ctx neighborhood:881 fusion:900 cooccurence:738 coexpression:891 database:900 textmining:954
Rv0772 purD phosphoribosylamine--glycine ligase 997 997 ctx fusion:900 cooccurence:772 coexpression:848
Rv0780 purC phosphoribosylaminoimidazole-succinocarboxamide synthase 992 991 coexpression:858 database:900
Rv0809 purM phosphoribosylformylglycinamidine cyclo-ligase PurM 976 970 ctx cooccurence:768 coexpression:858
Rv0808 purF amidophosphoribosyltransferase 997 965 ctx cooccurence:728 coexpression:858 textmining:927
Rv0957 purH bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/inosinemonophosphate cyclohydrolase 966 955 ctx cooccurence:679 coexpression:856
Rv0956 purN phosphoribosylglycinamide formyltransferase PurN 961 949 ctx cooccurence:608 coexpression:859
Rv0788 purQ phosphoribosylformylglycinamidine synthase 960 948 ctx cooccurence:620 coexpression:858
Rv0803 purL phosphoribosylformylglycinamidine synthase 2 952 938 ctx cooccurence:547 coexpression:859
Rv0777 purB adenylosuccinate lyase PurB 920 874 coexpression:856
Rv0787A purS hyp hypothetical protein 886 865 coexpression:854
Rv3274c fadE25 acyl-CoA dehydrogenase 853 854 ctx neighborhood:849
Rv1384 carB carbamoyl-phosphate synthase large subunit 766 721 coexpression:651
Rv1383 carA carbamoyl-phosphate synthase small subunit 732 716 coexpression:651
Rv0357c purA adenylosuccinate synthetase 752 678 coexpression:651

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: 5-(carboxyamino)imidazole ribonucleotide mutase
  • MTBC0 PGAP product: 5-(carboxyamino)imidazole ribonucleotide mutase
  • Pfam (hmmscan --cut_ga): AIRC PF00731.27 (E=2e-64)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217792.1)
  • Domains: Pfam-A via hmmscan --cut_ga — AIRC (PF00731.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0041
  • Curated reference: UniProt P9WHM1 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 57 functional partner(s); context anchor purK
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003483|Rv3275c|purE
MTPAGERPRVGVIMGSDSDWPVMADAAAALAEFDIPAEVRVVSAHRTPEAMFSYARGAAERGLEVIIAGAGGAAHLPGMVAAATPLPVIGVPVPLGRLDGLDSLLSIVQMPAGVPVATVSIGGARNAGLLAVRMLGAANPQLRARIVAFQDRLADVVAAKDAELQRLAGKLTRD