purE Resolved · high auto-curated
H37Rv Rv3275c · MTBC0 mtbc0_003483 ·
174 aa · 3680257–3680781 (-) ·
RefSeq NP_217792.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | 5-(carboxyamino)imidazole ribonucleotide mutase |
|---|---|
| MTBC0 PGAP re-annotation | 5-(carboxyamino)imidazole ribonucleotide mutase |
| Revised (this work) | 5-(carboxyamino)imidazole ribonucleotide mutase. Pfam: AIRC (PF00731.27). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WHM1
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | N5-carboxyaminoimidazole ribonucleotide mutase |
| EC (curated) |
EC 5.4.99.18
|
| Curated function | Catalyzes the conversion of N5-carboxyaminoimidazole ribonucleotide (N5-CAIR) to 4-carboxy-5-aminoimidazole ribonucleotide (CAIR). |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
F Nucleotide transport and metabolism
|
|---|---|
| Preferred name | purE |
| eggNOG description | Catalyzes the conversion of N5-carboxyaminoimidazole ribonucleotide (N5-CAIR) to 4-carboxy-5-aminoimidazole ribonucleotide (CAIR) |
| Orthologous group | COG0041 |
| EC number |
EC 5.4.99.18
|
| KEGG orthology |
K01588
|
| KEGG pathways |
map00230, map01100, map01110, map01130
|
| KEGG modules |
M00048
|
| Gene Ontology (2) |
GO:0008150, GO:0040007
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.231 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 5 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
AIRC | PF00731.27 | 1.6e-64 | 9–153 | AIR carboxylase |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: purK (5-(carboxyamino)imidazole ribonucleotide synthase), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3276c purK |
5-(carboxyamino)imidazole ribonucleotide synthase | 999 | 1000 ctx | neighborhood:881 fusion:900 cooccurence:738 coexpression:891 database:900 textmining:954 |
Rv0772 purD |
phosphoribosylamine--glycine ligase | 997 | 997 ctx | fusion:900 cooccurence:772 coexpression:848 |
Rv0780 purC |
phosphoribosylaminoimidazole-succinocarboxamide synthase | 992 | 991 | coexpression:858 database:900 |
Rv0809 purM |
phosphoribosylformylglycinamidine cyclo-ligase PurM | 976 | 970 ctx | cooccurence:768 coexpression:858 |
Rv0808 purF |
amidophosphoribosyltransferase | 997 | 965 ctx | cooccurence:728 coexpression:858 textmining:927 |
Rv0957 purH |
bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/inosinemonophosphate cyclohydrolase | 966 | 955 ctx | cooccurence:679 coexpression:856 |
Rv0956 purN |
phosphoribosylglycinamide formyltransferase PurN | 961 | 949 ctx | cooccurence:608 coexpression:859 |
Rv0788 purQ |
phosphoribosylformylglycinamidine synthase | 960 | 948 ctx | cooccurence:620 coexpression:858 |
Rv0803 purL |
phosphoribosylformylglycinamidine synthase 2 | 952 | 938 ctx | cooccurence:547 coexpression:859 |
Rv0777 purB |
adenylosuccinate lyase PurB | 920 | 874 | coexpression:856 |
Rv0787A purS hyp |
hypothetical protein | 886 | 865 | coexpression:854 |
Rv3274c fadE25 |
acyl-CoA dehydrogenase | 853 | 854 ctx | neighborhood:849 |
Rv1384 carB |
carbamoyl-phosphate synthase large subunit | 766 | 721 | coexpression:651 |
Rv1383 carA |
carbamoyl-phosphate synthase small subunit | 732 | 716 | coexpression:651 |
Rv0357c purA |
adenylosuccinate synthetase | 752 | 678 | coexpression:651 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: 5-(carboxyamino)imidazole ribonucleotide mutase
- MTBC0 PGAP product: 5-(carboxyamino)imidazole ribonucleotide mutase
- Pfam (hmmscan --cut_ga): AIRC PF00731.27 (E=2e-64)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217792.1)
- Domains: Pfam-A via hmmscan --cut_ga — AIRC (PF00731.27)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0041 - Curated reference: UniProt P9WHM1 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
57 functional partner(s); context anchor
purK - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003483|Rv3275c|purE MTPAGERPRVGVIMGSDSDWPVMADAAAALAEFDIPAEVRVVSAHRTPEAMFSYARGAAERGLEVIIAGAGGAAHLPGMVAAATPLPVIGVPVPLGRLDGLDSLLSIVQMPAGVPVATVSIGGARNAGLLAVRMLGAANPQLRARIVAFQDRLADVVAAKDAELQRLAGKLTRD