Rv3278c Family assigned · medium auto-curated

H37Rv Rv3278c · MTBC0 mtbc0_003486 · 172 aa · 3682794–3683312 MTBC0 (-) · RefSeq NP_217795.1

Genomic neighbourhood (genome browser)

Open in full genome browser →
+ strand − strand lcp1 (Rv3267) — requalified: phosphotransferase Lcp1 Rv3269 (Rv3269) — family_assigned: DUF1490 family protein ctpC (Rv3270) — requalified: manganese-exporting P-type ATPase CtpC ctpC Rv3271c (Rv3271c) — requalified: cation transporter Rv3272 (Rv3272) — requalified: CoA transferase Rv3272 fadE25 (Rv3274c) — requalified: acyl-CoA dehydrogenase fadE25 purE (Rv3275c) — requalified: 5-(carboxyamino)imidazole ribonucleotide mutase purK (Rv3276c) — requalified: 5-(carboxyamino)imidazole ribonucleotide synthase purK Rv3278c (Rv3278c) — family_assigned: PH domain-containing protein birA (Rv3279c) — requalified: biotin--[acetyl-CoA-carboxylase] ligase accD5 (Rv3280) — family_assigned: acyl-CoA carboxylase subunit beta accD5 accE5 (Rv3281) — family_assigned: acyl-CoA carboxylase subunit epsilon Rv3282 (Rv3282) — requalified: nucleoside triphosphate pyrophosphatase sseA (Rv3283) — requalified: sulfurtransferase sseA Rv3284 (Rv3284) — family_assigned: SufE family protein accA3 (Rv3285) — family_assigned: acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alph accA3 sigF (Rv3286c) — requalified: RNA polymerase sigma factor SigF rsbW (Rv3287c) — requalified: anti-sigma B factor RsbW Rv3289c (Rv3289c) — dark: hypothetical protein lat (Rv3290c) — requalified: L-lysine 6-transaminase lat lrpA (Rv3291c) — family_assigned: transcriptional regulator LrpA Rv3292 (Rv3292) — family_assigned: VOC family protein 3 672 kb 3 676 kb 3 680 kb 3 684 kb 3 688 kb 3 692 kb

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transmembrane protein
MTBC0 PGAP re-annotationPH domain-containing protein
Revised (this work)PH domain-containing protein. Pfam: bPH_2 (PF03703.21).
Functional category (TubercuList)cell wall and cell processes

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) never studied

No publication mentions this gene in its title or abstract — not under its H37Rv locus tag, not under its gene name, and not under any ortholog identifier. Its annotation rests on sequence/structure evidence, with no primary study behind it.

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

Genomic-neighbour overlap (structural caveat) antiparallel · 9 % of gene

NeighbourRv3277 (Rv3277, + strand)
Overlap46 bp, 9 % of this gene's length

antiparallel overlap: this gene may inherit essentiality/conservation signal from its neighbour through shared TA sites or promoter constraint, without any protein of its own being produced (cf. Rv2438A/nadE) Signals attributed to this gene (Tn-seq essentiality via shared TA sites, conservation via promoter constraint) should be cross-checked against the neighbour before being read as its own. P20.1, derived from GFF3 gene coordinates, 2026-08-03.

CRISPRi vulnerability

Vulnerability index -0.64 (95% CI -0.80 to -0.48). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb3306c · 99.4% identity
M. leprae ML0733 · 83.1% identity
M. marinum MMAR_1258 · 89.0% identity
M. smegmatis MSMEG_1818 · 75.0% identity
M. orygis RJtmp_003378 · 100.0% identity
M. abscessus MAB_3625c · 72.1% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P96883 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable conserved transmembrane protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionBacterial PH domain
Orthologous groupCOG3428

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.082 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Actinomycetia

M. canettii dN/dS (deep-divergence selection) 0.066 (low power) · 7 consensus substitution(s)
low power (7 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 53/53 (100%) · mean identity 84.2% · 4/4 closest MTBAP relatives
conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 6/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 50.0%
detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callGA · growth-advantage
What the call meansgrowth-advantage: insertions enriched
TA sites (Himar1) 8 in the ORF — 0 in the essential state, 0 growth-defect, 0 non-essential, 8 growth-advantage. Saturation 1.000, mean read count 238.125. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.
CaveatRead with some caution: only 8 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 8 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3)

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype

Conditionlog2FCqEffect
altered fitness under Ethambutol (drug exposure) -2.370.005 required
fitness in mouse infection (in vivo) +2.370.01 disruption advantageous
fitness in mouse infection (in vivo) +1.970.023 disruption advantageous
fitness in mouse infection (in vivo) +1.970.0094 disruption advantageous
fitness in mouse infection (in vivo) +1.720.034 disruption advantageous
fitness in mouse infection (in vivo) +1.190.03 disruption advantageous

Conditional fitness of transposon-disruption mutants across 6 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.

Proteomics (mass spectrometry) detected

MS detectiondetected in 10 of 16 independent MS datasets
Integrated abundance72.4 ppm · rank 1505/3519 (57.3th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Predicted localisation (DeepTMHMM + lipobox)

Predictionpredicted membrane protein (2 TM helixes)
DeepTMHMM classTM
TM helices (DeepTMHMM)2

Transmembrane topology and signal peptide from DeepTMHMM (deep-learning reference predictor); lipoproteins from a (myco)bacterial lipobox motif. A sequence-based prediction of subcellular context.

Physico-chemical properties (computed, ProtParam)

Length172 aa
Molecular weight19.8 kDa
Theoretical pI7.11
GRAVY0.267 (hydrophobic)
Aliphatic index114.4
Aromaticity0.122
Instability index40.1 (unstable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
bPH_2PF03703.21 7.2e-2082–155 Bacterial PH domain

Genomic context (neighbours & predicted operon) operon of 2

Upstream (5' on genome)Rv3277 (+ strand, -46 bp gap)
Downstream (3' on genome)birA (- strand, 42 bp gap)
Predicted operon Rv3278c · birA

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: birA (bifunctional biotin operon repressor/biotin--[acetyl-CoA-carboxylase), high confidence from genomic context alone (score 823 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3279c birA bifunctional biotin operon repressor/biotin--[acetyl-CoA-carboxylase 822 823 ctx neighborhood:822
Rv3281 accE5 bifunctional protein acetyl-/propionyl-CoAcarboxylase subunit epsilon AccE 752 752 ctx neighborhood:748
Rv3280 accD5 propionyl-CoA carboxylase subunit beta 750 749 ctx neighborhood:748
Rv3282 hyp hypothetical protein 749 749 ctx neighborhood:748
Rv1227c transmembrane protein 633 585 coexpression:561
Rv1234 transmembrane protein 585 584 coexpression:498
Rv2744c 35kd_ag hyp hypothetical protein 523 524 ctx cooccurence:455
Rv3283 sseA thiosulfate sulfurtransferase SseA 490 489 ctx neighborhood:489
Rv2468c hyp hypothetical protein 477 478
Rv3284 hyp hypothetical protein 475 475 ctx neighborhood:474
Rv1638A hyp hypothetical protein 474 475
Rv0049 hyp hypothetical protein 472 472 ctx cooccurence:469
Rv1481 membrane protein 449 450 ctx cooccurence:432
Rv2062c cobN cobalamin biosynthesis protein CobN 446 447 coexpression:415
Rv3221A rshA anti-sigma factor RshA 445 446

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: transmembrane protein
  • MTBC0 PGAP product: PH domain-containing protein
  • Pfam (hmmscan --cut_ga): bPH_2 PF03703.21 (E=7e-20)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217795.1)
  • Domains: Pfam-A via hmmscan --cut_ga — bPH_2 (PF03703.21)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3428
  • Curated reference: UniProt P96883 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 18 functional partner(s); context anchor birA
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Predicted localisation: DeepTMHMM (Hallgren et al. 2022, doi:10.1101/2022.04.08.487609) for transmembrane topology and signal peptide
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003486|Rv3278c|
MSYPENVLAAGEQVVLHRHPHWNRLIWPVVVLVLLTGLAAFGSGFVNSTPWQQIAKNVIHAVIWGIWLVIVGWLTLWPFLSWLTTHFVVTNRRVMFRHGVLTRSGIDIPLARINSVEFRDRIFERIFRTGTLIIESASQDPLEFYNIPRLREVHALLYHEVFDTLGSDESPS