rsbW Resolved · medium auto-curated
H37Rv Rv3287c · MTBC0 mtbc0_003495 ·
145 aa · 3691031–3691468 (-) ·
RefSeq NP_217804.4
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | anti-sigma factor RsbW |
|---|---|
| MTBC0 PGAP re-annotation | anti-sigma B factor RsbW |
| Revised (this work) | Anti-sigma B factor RsbW. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WGX7
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Anti-sigma-F factor RsbW |
| Curated function | A cognate anti-sigma factor for alternative sigma factor SigF. Alternative sigma factors are held in an inactive form by an anti-sigma factor. Binds ATP and GTP, may hydrolyze both. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
T Signal transduction mechanisms
|
|---|---|
| Preferred name | rsbW |
| eggNOG description | Anti-sigma regulatory factor (Ser Thr protein kinase) |
| Orthologous group | COG2172 |
| EC number |
EC 2.7.11.1
|
| KEGG orthology |
K04757
|
| Gene Ontology (46) |
GO:0000166, GO:0000988, GO:0000989, GO:0003674, GO:0005488, GO:0006355, GO:0008150, GO:0009889, GO:0009890, GO:0009892, GO:0010468, GO:0010556 +34 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.0 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 0 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: sigF (RNA polymerase sigma factor SigF), high confidence from genomic context alone (score 989 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3286c sigF |
RNA polymerase sigma factor SigF | 998 | 989 ctx | neighborhood:802 cooccurence:407 coexpression:840 experimental:471 textmining:859 |
Rv1364c |
sigma factor regulatory protein | 990 | 987 | coexpression:959 experimental:658 |
Rv1365c rsfA |
anti-sigma-F factor antagonist RsfA | 952 | 901 ctx | cooccurence:441 coexpression:507 experimental:658 textmining:538 |
Rv1904 hyp |
hypothetical protein | 913 | 877 | coexpression:509 experimental:658 |
Rv3687c rsfB |
anti-anti-sigma factor RsfB | 952 | 857 | coexpression:506 experimental:658 textmining:684 |
Rv3288c usfY hyp |
hypothetical protein | 858 | 853 ctx | neighborhood:463 coexpression:738 |
Rv2638 hyp |
hypothetical protein | 893 | 846 ctx | cooccurence:452 coexpression:510 experimental:454 |
Rv1354c hyp |
hypothetical protein | 846 | 821 | coexpression:692 |
Rv1173 fbiC |
FO synthase | 780 | 780 | coexpression:732 |
Rv1486c hyp |
hypothetical protein | 751 | 752 ctx | cooccurence:750 |
Rv0516c oprA |
anti-anti-sigma factor | 844 | 728 | coexpression:506 experimental:454 textmining:452 |
Rv2743c hyp |
hypothetical protein | 641 | 642 ctx | cooccurence:638 |
Rv0164 TB18.5 hyp |
hypothetical protein | 622 | 622 ctx | cooccurence:621 |
Rv2712c hyp |
hypothetical protein | 606 | 606 ctx | cooccurence:604 |
Rv0431 |
tuberculin-like peptide | 592 | 592 ctx | cooccurence:591 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: anti-sigma factor RsbW
- MTBC0 PGAP product: anti-sigma B factor RsbW
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217804.4)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2172 - Curated reference: UniProt P9WGX7 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
69 functional partner(s); context anchor
sigF - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003495|Rv3287c|rsbW MADSDLPTKGRQRGVRAVELNVAARLENLALLRTLVGAIGTFEDLDFDAVADLRLAVDEVCTRLIRSALPDATLRLVVDPRKDEVVVEASAACDTHDVVAPGSFSWHVLTALADDVQTFHDGRQPDVAGSVFGITLTARRAASSR