rsbW Resolved · medium auto-curated

H37Rv Rv3287c · MTBC0 mtbc0_003495 · 145 aa · 3691031–3691468 (-) · RefSeq NP_217804.4

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)anti-sigma factor RsbW
MTBC0 PGAP re-annotationanti-sigma B factor RsbW
Revised (this work)Anti-sigma B factor RsbW.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WGX7 SwissProt · reviewed · Evidence at protein level
UniProt nameAnti-sigma-F factor RsbW
Curated functionA cognate anti-sigma factor for alternative sigma factor SigF. Alternative sigma factors are held in an inactive form by an anti-sigma factor. Binds ATP and GTP, may hydrolyze both.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category T Signal transduction mechanisms
Preferred namersbW
eggNOG descriptionAnti-sigma regulatory factor (Ser Thr protein kinase)
Orthologous groupCOG2172
EC number EC 2.7.11.1
KEGG orthology K04757
Gene Ontology (46) GO:0000166, GO:0000988, GO:0000989, GO:0003674, GO:0005488, GO:0006355, GO:0008150, GO:0009889, GO:0009890, GO:0009892, GO:0010468, GO:0010556 +34 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: sigF (RNA polymerase sigma factor SigF), high confidence from genomic context alone (score 989 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3286c sigF RNA polymerase sigma factor SigF 998 989 ctx neighborhood:802 cooccurence:407 coexpression:840 experimental:471 textmining:859
Rv1364c sigma factor regulatory protein 990 987 coexpression:959 experimental:658
Rv1365c rsfA anti-sigma-F factor antagonist RsfA 952 901 ctx cooccurence:441 coexpression:507 experimental:658 textmining:538
Rv1904 hyp hypothetical protein 913 877 coexpression:509 experimental:658
Rv3687c rsfB anti-anti-sigma factor RsfB 952 857 coexpression:506 experimental:658 textmining:684
Rv3288c usfY hyp hypothetical protein 858 853 ctx neighborhood:463 coexpression:738
Rv2638 hyp hypothetical protein 893 846 ctx cooccurence:452 coexpression:510 experimental:454
Rv1354c hyp hypothetical protein 846 821 coexpression:692
Rv1173 fbiC FO synthase 780 780 coexpression:732
Rv1486c hyp hypothetical protein 751 752 ctx cooccurence:750
Rv0516c oprA anti-anti-sigma factor 844 728 coexpression:506 experimental:454 textmining:452
Rv2743c hyp hypothetical protein 641 642 ctx cooccurence:638
Rv0164 TB18.5 hyp hypothetical protein 622 622 ctx cooccurence:621
Rv2712c hyp hypothetical protein 606 606 ctx cooccurence:604
Rv0431 tuberculin-like peptide 592 592 ctx cooccurence:591

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: anti-sigma factor RsbW
  • MTBC0 PGAP product: anti-sigma B factor RsbW
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217804.4)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2172
  • Curated reference: UniProt P9WGX7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 69 functional partner(s); context anchor sigF
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003495|Rv3287c|rsbW
MADSDLPTKGRQRGVRAVELNVAARLENLALLRTLVGAIGTFEDLDFDAVADLRLAVDEVCTRLIRSALPDATLRLVVDPRKDEVVVEASAACDTHDVVAPGSFSWHVLTALADDVQTFHDGRQPDVAGSVFGITLTARRAASSR