rsbW Resolved · medium auto-curated
H37Rv Rv3287c · MTBC0 mtbc0_003495 ·
145 aa ·
3691031–3691468 MTBC0
(-) ·
RefSeq NP_217804.4
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | anti-sigma factor RsbW |
|---|---|
| MTBC0 PGAP re-annotation | anti-sigma B factor RsbW |
| Revised (this work) | Anti-sigma B factor RsbW. |
| Functional category (TubercuList) | information pathways |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 10 publications
10 TB publications mention this gene. 10 publication(s) discuss this gene (8 in a M. tuberculosis context, 4 in other mycobacteria — M. smegmatis (4)).
| Publication | Date |
|---|---|
| The Partner Switching System of the SigF Sigma Factor in Mycobacterium smegmatis and Induction of the SigF Regulon Under Respiration-Inhibitory Conditions. doi:10.3389/fmicb.2020.588487 | 2020 |
| Characterization of Mycobacterium smegmatis sigF mutant and its regulon: overexpression of SigF antagonist (MSMEG_1803) in M. smegmatis mimics sigF mutant phenotype, loss of pigmentation, and sensitivity to oxidative stress. doi:10.1002/mbo3.288 | 2015 |
| Structural characterization of the multidomain regulatory protein Rv1364c from Mycobacterium tuberculosis. doi:10.1016/j.str.2010.11.010 | 2011 |
| Loss of kinase activity in Mycobacterium tuberculosis multidomain protein Rv1364c. doi:10.1111/j.1742-4658.2008.06753.x | 2008 |
| The alternative sigma factor SigF of Mycobacterium smegmatis is required for survival of heat shock, acidic pH and oxidative stress. doi:10.1099/mic.0.2008/018044-0 | 2008 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 1 % of gene
| Neighbour | sigF (Rv3286c, - strand) |
|---|---|
| Overlap | 4 bp, 1 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index 0.18 (95% CI -1.30 to 2.12). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Binds to sigma and blocks its ability to form an RNA polymerase holoenzyme. Regulates negatively SIGF|Rv3286c, and negatively regulated by Rv1365c|RSFA and Rv3687C|RSFB. |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb3315c
· 100.0% identity |
|---|---|
| M. marinum |
MMAR_1247
· 83.4% identity |
| M. smegmatis |
MSMEG_1803
· 65.4% identity |
| M. orygis |
RJtmp_003387
· 100.0% identity |
| M. abscessus |
MAB_2513c
· 44.4% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WGX7
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Anti-sigma-F factor RsbW |
| Curated function | A cognate anti-sigma factor for alternative sigma factor SigF. Alternative sigma factors are held in an inactive form by an anti-sigma factor. Binds ATP and GTP, may hydrolyze both. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
T Signal transduction mechanisms
|
|---|---|
| Preferred name | rsbW |
| eggNOG description | Anti-sigma regulatory factor (Ser Thr protein kinase) |
| Orthologous group | COG2172 |
| EC number |
EC 2.7.11.1
|
| KEGG orthology |
K04757
|
| Gene Ontology (46) |
GO:0000166, GO:0000988, GO:0000989, GO:0003674, GO:0005488, GO:0006355, GO:0008150, GO:0009889, GO:0009890, GO:0009892, GO:0010468, GO:0010556 +34 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.0 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 0 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Actinomycetia
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 1 consensus substitution(s) low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 81.2%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 5/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 37.5% detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | GA · growth-advantage |
|---|---|
| What the call means | growth-advantage: insertions enriched |
| TA sites (Himar1) | 3 in the ORF — 0 in the essential state, 0 growth-defect, 0 non-essential, 3 growth-advantage. Saturation 1.000, mean read count 128.333333333. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | Statistically thin call: only 3 TA (Himar1) sites in the whole ORF (atlas median 13; genes under 300 nt typically have very few). A DeJesus 2017 call built on so few independent observations is less robust than the same call on a longer gene, in either direction. Cross-check against the CRISPRi vulnerability index (independent of TA-site density) and, if this gene overlaps a neighbour (see Genomic-neighbour overlap section below), verify how many of its TA sites actually fall inside its own ORF. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 10 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 34.5 ppm · rank 1998/3519 (43.3th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 145 aa |
|---|---|
| Molecular weight | 15.6 kDa |
| Theoretical pI | 4.95 |
| GRAVY | 0.083 (hydrophobic) |
| Aliphatic index | 104.3 |
| Aromaticity | 0.041 |
| Instability index | 35.4 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Experimental structures (Protein Data Bank) 2 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
8ih8 |
X-ray diffraction | 2.0 Å | 86% |
8jzt |
X-ray diffraction | 1.94 Å | 80% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (2 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 82.5
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
8jzt-assembly1_B |
1.00 | 0.91 | 5.6e-20 sig | 8jzt-assembly1_B The sigF and anti-sigma factor complex |
6m37-assembly1_C-2 |
1.00 | 0.81 | 1.1e-07 sig | 6m37-assembly1_C-2 The crystal structure of B. subtilis RsbV/RsbW complex in the hexagonal crystal form |
6m36-assembly2_K |
1.00 | 0.90 | 1.9e-06 sig | 6m36-assembly2_K The crystal structure of B. subtilis RsbV/RsbW complex in the monoclinic crystal form |
6m36-assembly1_E |
1.00 | 0.90 | 4.5e-06 sig | 6m36-assembly1_E The crystal structure of B. subtilis RsbV/RsbW complex in the monoclinic crystal form |
6m37-assembly1_A-2 |
1.00 | 0.77 | 4.1e-07 sig | 6m37-assembly1_A-2 The crystal structure of B. subtilis RsbV/RsbW complex in the hexagonal crystal form |
Foldseek search of the AlphaFold DB model (mean pLDDT 82.5, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 2
| Upstream (5' on genome) | sigF (- strand, -4 bp gap) |
|---|---|
| Downstream (3' on genome) | usfY (- strand, 197 bp gap) |
| Predicted operon |
sigF · rsbW
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (1 TF) |
sigF (activates)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: sigF (RNA polymerase sigma factor SigF), high confidence from genomic context alone (score 989 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3286c sigF exp |
RNA polymerase sigma factor SigF | 998 | 989 ctx | neighborhood:802 cooccurence:407 coexpression:840 experimental:471 textmining:859 |
Rv1364c exp |
sigma factor regulatory protein | 990 | 987 | coexpression:959 experimental:658 |
Rv1365c rsfA exp |
anti-sigma-F factor antagonist RsfA | 952 | 901 ctx | cooccurence:441 coexpression:507 experimental:658 textmining:538 |
Rv1904 hyp exp |
hypothetical protein | 913 | 877 | coexpression:509 experimental:658 |
Rv3687c rsfB exp |
anti-anti-sigma factor RsfB | 952 | 857 | coexpression:506 experimental:658 textmining:684 |
Rv3288c usfY hyp |
hypothetical protein | 858 | 853 ctx | neighborhood:463 coexpression:738 |
Rv2638 hyp exp |
hypothetical protein | 893 | 846 ctx | cooccurence:452 coexpression:510 experimental:454 |
Rv1354c hyp |
hypothetical protein | 846 | 821 | coexpression:692 |
Rv1173 fbiC |
FO synthase | 780 | 780 | coexpression:732 |
Rv1486c hyp |
hypothetical protein | 751 | 752 ctx | cooccurence:750 |
Rv0516c oprA exp |
anti-anti-sigma factor | 844 | 728 | coexpression:506 experimental:454 textmining:452 |
Rv2743c hyp |
hypothetical protein | 641 | 642 ctx | cooccurence:638 |
Rv0164 TB18.5 hyp |
hypothetical protein | 622 | 622 ctx | cooccurence:621 |
Rv2712c hyp |
hypothetical protein | 606 | 606 ctx | cooccurence:604 |
Rv0431 |
tuberculin-like peptide | 592 | 592 ctx | cooccurence:591 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: anti-sigma factor RsbW
- MTBC0 PGAP product: anti-sigma B factor RsbW
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217804.4)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2172 - Curated reference: UniProt P9WGX7 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 82.5)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
69 functional partner(s); context anchor
sigF - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003495|Rv3287c|rsbW MADSDLPTKGRQRGVRAVELNVAARLENLALLRTLVGAIGTFEDLDFDAVADLRLAVDEVCTRLIRSALPDATLRLVVDPRKDEVVVEASAACDTHDVVAPGSFSWHVLTALADDVQTFHDGRQPDVAGSVFGITLTARRAASSR
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for rsbW? Email the maintainer — the message is pre-filled with this gene's details.