nei Resolved · high auto-curated

H37Rv Rv3297 · MTBC0 mtbc0_003505 · 255 aa · 3703400–3704167 MTBC0 (+) · RefSeq NP_217814.1

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)endonuclease VIII
MTBC0 PGAP re-annotationendonuclease VIII Nei2
Revised (this work)Endonuclease VIII Nei2. Pfam: Fapy_DNA_glyco (PF01149.30), H2TH (PF06831.20).
Functional category (TubercuList)information pathways

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 17 publications

17 TB publications mention this gene. 17 publication(s) discuss this gene (15 in a M. tuberculosis context, 3 in other mycobacteria — M. smegmatis (2), M. leprae (1)).

Most recent 5 of 17.
PublicationDate
Novel mutations found in Mycobacterium leprae DNA repair gene nth from central India. doi:10.1016/j.jiac.2023.12.011 2024
Use of transcutaneous electrical acupoint stimulation in pulmonary surgery for patients with tuberculosis. doi:10.1016/j.jctube.2022.100298 2022
Mycobacterium tuberculosis Endonuclease VIII 2 (Nei2) forms a prereplicative BER complex with DnaN: Identification, characterization, and disruption of complex formation. doi:10.1111/mmi.14848 2022
Experience of nursing students regarding clinical support in the management of TB and HIV patients in a primary healthcare setting: a phenomenological study. doi:10.11604/pamj.2019.33.209.15819 2019
The neuro-endocrine-immune relationship in pulmonary and pleural tuberculosis: a better local profile in pleural fluid. doi:10.5588/ijtld.17.0270 2018

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

Conditional expression context (iModulons)

Member of 1 independently-modulated gene set(s): WhiB4 (whiB4).

iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).

CRISPRi vulnerability

Vulnerability index 0.45 (95% CI -0.50 to 1.81). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionInvolved in damage reversal. DNA N-glycosylase with an AP lyase activity. Required for the repair of oxidative DNA damage (oxidized pyrimidines).
Mycobrowser EC 3.2.2.-, 4.2.99.18 · agrees with the atlas

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb3325 · 100.0% identity
M. marinum MMAR_1237 · 77.9% identity
M. smegmatis MSMEG_1756 · 68.1% identity
M. orygis RJtmp_003397 · 99.6% identity
M. abscessus MAB_4728c · 57.8% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WNC1 SwissProt · reviewed · Inferred from homology
UniProt nameEndonuclease 8 2
EC (curated) EC 3.2.2.-, EC 4.2.99.18
Curated functionInvolved in base excision repair of DNA damaged by oxidation or by mutagenic agents. Acts as a DNA glycosylase that recognizes and removes damaged bases. Has AP (apurinic/apyrimidinic) lyase activity and introduces nicks in the DNA strand. Cleaves the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates (By similarity). Complements an E.coli nei nth double mutant.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category L Replication, recombination and repair
Preferred namenei
eggNOG descriptionBelongs to the FPG family
Orthologous groupCOG0266
EC number EC 4.2.99.18
KEGG orthology K05522
KEGG pathways map03410
Gene Ontology (35) GO:0003674, GO:0003676, GO:0003677, GO:0003690, GO:0003824, GO:0005488, GO:0006139, GO:0006259, GO:0006281, GO:0006725, GO:0006807, GO:0006950 +23 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.066 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Actinomycetia

M. canettii dN/dS (deep-divergence selection) 0.119 (low power) · 4 consensus substitution(s)
low power (4 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 50/53 (94%) · mean identity 77.3% · 4/4 closest MTBAP relatives
conserved across the genus (present in 50/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 9/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 47.6%
detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 10 in the ORF — 0 in the essential state, 0 growth-defect, 10 non-essential, 0 growth-advantage. Saturation 0.900, mean read count 131.777777778. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) detected

MS detectiondetected in 7 of 16 independent MS datasets
Integrated abundance4.94 ppm · rank 2946/3519 (16.3th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length255 aa
Molecular weight28.5 kDa
Theoretical pI9.09
GRAVY-0.224 (hydrophilic)
Aliphatic index93.7
Aromaticity0.059
Instability index33.2 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Fapy_DNA_glycoPF01149.30 2.0e-121–93 Formamidopyrimidine-DNA glycosylase N-terminal domain
H2THPF06831.20 3.6e-10123–186 Formamidopyrimidine-DNA glycosylase H2TH domain

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 95.6

PDB hitprobTM-scoreE-valueDescription
8tjg-assembly1_A 1.00 0.96 1.6e-40 sig 8tjg-assembly1_A Structure of Nei2 from Mycobacterium smegmatis in complex with Zn2+
1k3x-assembly1_A 1.00 0.85 2.8e-23 sig 1k3x-assembly1_A Crystal structure of a trapped reaction intermediate of the DNA repair enzyme Endonuclease VIII with Brominated-DNA
1k3w-assembly1_A 1.00 0.84 3.4e-23 sig 1k3w-assembly1_A Crystal structure of a trapped reaction intermediate of the DNA Repair Enzyme Endonuclease VIII with DNA
2opf-assembly1_A 1.00 0.83 4.1e-23 sig 2opf-assembly1_A Crystal structure of the DNA repair enzyme endonuclease-VIII (Nei) from E. coli (R252A) in complex with AP-site containing DNA substrate
6fbu-assembly1_A 1.00 0.85 2.3e-22 sig 6fbu-assembly1_A Crystal structure of the DNA repair enzyme endonuclease-VIII (Nei) from E. coli (E2Q) in complex with AP-site containing DNA substrate

Foldseek search of the AlphaFold DB model (mean pLDDT 95.6, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 3

Upstream (5' on genome)lhr (+ strand, 3 bp gap)
Downstream (3' on genome)lpqC (- strand, 22 bp gap)
Predicted operon Rv3295 · lhr · nei

Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE)

Regulated by (1 TF) Rv3736 (represses)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: lhr (ATP-dependent helicase), high confidence from genomic context alone (score 985 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3296 lhr ATP-dependent helicase 996 985 ctx neighborhood:881 coexpression:839 textmining:803
Rv2464c nei1 exp DNA glycosylase 924 924 database:900
Rv3555c hyp hypothetical protein 820 820 coexpression:817
Rv3295 TetR family transcriptional regulator 819 819 ctx neighborhood:818
Rv1629 polA DNA polymerase I 864 815 coexpression:790
Rv2191 hyp hypothetical protein 834 803 coexpression:797
Rv0944 fpg2 formamidopyrimidine-DNA glycosylase 968 766 ctx cooccurence:766 textmining:870
Rv3293 pcd piperideine-6-carboxylic acid dehydrogenase 532 532 ctx neighborhood:531
Rv1631 coaE dephospho-CoA kinase CoaE 555 513 coexpression:471
Rv3294c hyp hypothetical protein 493 494 ctx neighborhood:491
Rv2090 5'-3' exonuclease 478 446 coexpression:427
Rv1870c hyp hypothetical protein 449 418 coexpression:418
Rv1156 hyp hypothetical protein 446 415 coexpression:415
Rv3674c nth endonuclease III 924 414 coexpression:414 textmining:877
Rv1407 fmu 16S rRNA m5C967 methyltransferase 404 405

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: endonuclease VIII
  • MTBC0 PGAP product: endonuclease VIII Nei2
  • Pfam (hmmscan --cut_ga): Fapy_DNA_glyco PF01149.30 (E=2e-12), H2TH PF06831.20 (E=4e-10)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217814.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Fapy_DNA_glyco (PF01149.30), H2TH (PF06831.20)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0266
  • Curated reference: UniProt P9WNC1 (SwissProt, reviewed; Inferred from homology)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 95.6)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 23 functional partner(s); context anchor lhr
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003505|Rv3297|nei
MPEGDTVWHTAATLRRHLAGRTLTRCDIRVPRFAAVDLTGEVVDEVISRGKHLFIRTGTASIHSHLQMDGSWRVGNRPVRVDHRARIILEANQQEQAIRVVGVDLGLLEVIDRHNDGAVVAHLGPDLLADDWDPQRAAANLIVAPDRPIAEALLDQRVLAGIGNVYCNELCFVSGVLPTAPVSAVADPRRLVTRARDMLWVNRFRWNRCTTGDTRAGRRLWVYGRAGQGCRRCGTLIAYDTTDERVRYWCPACQR