nei Resolved · high auto-curated
H37Rv Rv3297 · MTBC0 mtbc0_003505 ·
255 aa ·
3703400–3704167 MTBC0
(+) ·
RefSeq NP_217814.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | endonuclease VIII |
|---|---|
| MTBC0 PGAP re-annotation | endonuclease VIII Nei2 |
| Revised (this work) | Endonuclease VIII Nei2. Pfam: Fapy_DNA_glyco (PF01149.30), H2TH (PF06831.20). |
| Functional category (TubercuList) | information pathways |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 17 publications
17 TB publications mention this gene. 17 publication(s) discuss this gene (15 in a M. tuberculosis context, 3 in other mycobacteria — M. smegmatis (2), M. leprae (1)).
| Publication | Date |
|---|---|
| Novel mutations found in Mycobacterium leprae DNA repair gene nth from central India. doi:10.1016/j.jiac.2023.12.011 | 2024 |
| Use of transcutaneous electrical acupoint stimulation in pulmonary surgery for patients with tuberculosis. doi:10.1016/j.jctube.2022.100298 | 2022 |
| Mycobacterium tuberculosis Endonuclease VIII 2 (Nei2) forms a prereplicative BER complex with DnaN: Identification, characterization, and disruption of complex formation. doi:10.1111/mmi.14848 | 2022 |
| Experience of nursing students regarding clinical support in the management of TB and HIV patients in a primary healthcare setting: a phenomenological study. doi:10.11604/pamj.2019.33.209.15819 | 2019 |
| The neuro-endocrine-immune relationship in pulmonary and pleural tuberculosis: a better local profile in pleural fluid. doi:10.5588/ijtld.17.0270 | 2018 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Conditional expression context (iModulons)
Member of 1 independently-modulated gene set(s):
WhiB4 (whiB4).
iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).
CRISPRi vulnerability
Vulnerability index 0.45 (95% CI -0.50 to 1.81). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Involved in damage reversal. DNA N-glycosylase with an AP lyase activity. Required for the repair of oxidative DNA damage (oxidized pyrimidines). |
|---|---|
| Mycobrowser EC |
3.2.2.-, 4.2.99.18
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb3325
· 100.0% identity |
|---|---|
| M. marinum |
MMAR_1237
· 77.9% identity |
| M. smegmatis |
MSMEG_1756
· 68.1% identity |
| M. orygis |
RJtmp_003397
· 99.6% identity |
| M. abscessus |
MAB_4728c
· 57.8% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WNC1
SwissProt · reviewed
· Inferred from homology
|
|---|---|
| UniProt name | Endonuclease 8 2 |
| EC (curated) |
EC 3.2.2.-, EC 4.2.99.18
|
| Curated function | Involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. Acts as a DNA glycosylase that recognizes and removes damaged bases. Has AP (apurinic/apyrimidinic) lyase activity and introduces nicks in the DNA strand. Cleaves the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates (By similarity). Complements an E.coli nei nth double mutant. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
L Replication, recombination and repair
|
|---|---|
| Preferred name | nei |
| eggNOG description | Belongs to the FPG family |
| Orthologous group | COG0266 |
| EC number |
EC 4.2.99.18
|
| KEGG orthology |
K05522
|
| KEGG pathways |
map03410
|
| Gene Ontology (35) |
GO:0003674, GO:0003676, GO:0003677, GO:0003690, GO:0003824, GO:0005488, GO:0006139, GO:0006259, GO:0006281, GO:0006725, GO:0006807, GO:0006950 +23 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 1.066 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 6 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Actinomycetia
| M. canettii dN/dS (deep-divergence selection) |
0.119 (low power)
· 4 consensus substitution(s) low power (4 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 50/53 (94%) · mean identity 77.3%
· 4/4 closest MTBAP relatives conserved across the genus (present in 50/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 9/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 47.6% detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 10 in the ORF — 0 in the essential state, 0 growth-defect, 10 non-essential, 0 growth-advantage. Saturation 0.900, mean read count 131.777777778. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 7 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 4.94 ppm · rank 2946/3519 (16.3th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 255 aa |
|---|---|
| Molecular weight | 28.5 kDa |
| Theoretical pI | 9.09 |
| GRAVY | -0.224 (hydrophilic) |
| Aliphatic index | 93.7 |
| Aromaticity | 0.059 |
| Instability index | 33.2 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Fapy_DNA_glyco | PF01149.30 | 2.0e-12 | 1–93 | Formamidopyrimidine-DNA glycosylase N-terminal domain |
H2TH | PF06831.20 | 3.6e-10 | 123–186 | Formamidopyrimidine-DNA glycosylase H2TH domain |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 95.6
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
8tjg-assembly1_A |
1.00 | 0.96 | 1.6e-40 sig | 8tjg-assembly1_A Structure of Nei2 from Mycobacterium smegmatis in complex with Zn2+ |
1k3x-assembly1_A |
1.00 | 0.85 | 2.8e-23 sig | 1k3x-assembly1_A Crystal structure of a trapped reaction intermediate of the DNA repair enzyme Endonuclease VIII with Brominated-DNA |
1k3w-assembly1_A |
1.00 | 0.84 | 3.4e-23 sig | 1k3w-assembly1_A Crystal structure of a trapped reaction intermediate of the DNA Repair Enzyme Endonuclease VIII with DNA |
2opf-assembly1_A |
1.00 | 0.83 | 4.1e-23 sig | 2opf-assembly1_A Crystal structure of the DNA repair enzyme endonuclease-VIII (Nei) from E. coli (R252A) in complex with AP-site containing DNA substrate |
6fbu-assembly1_A |
1.00 | 0.85 | 2.3e-22 sig | 6fbu-assembly1_A Crystal structure of the DNA repair enzyme endonuclease-VIII (Nei) from E. coli (E2Q) in complex with AP-site containing DNA substrate |
Foldseek search of the AlphaFold DB model (mean pLDDT 95.6, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 3
| Upstream (5' on genome) | lhr (+ strand, 3 bp gap) |
|---|---|
| Downstream (3' on genome) | lpqC (- strand, 22 bp gap) |
| Predicted operon |
Rv3295 · lhr · nei
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (1 TF) |
Rv3736 (represses)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: lhr (ATP-dependent helicase), high confidence from genomic context alone (score 985 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3296 lhr |
ATP-dependent helicase | 996 | 985 ctx | neighborhood:881 coexpression:839 textmining:803 |
Rv2464c nei1 exp |
DNA glycosylase | 924 | 924 | database:900 |
Rv3555c hyp |
hypothetical protein | 820 | 820 | coexpression:817 |
Rv3295 |
TetR family transcriptional regulator | 819 | 819 ctx | neighborhood:818 |
Rv1629 polA |
DNA polymerase I | 864 | 815 | coexpression:790 |
Rv2191 hyp |
hypothetical protein | 834 | 803 | coexpression:797 |
Rv0944 fpg2 |
formamidopyrimidine-DNA glycosylase | 968 | 766 ctx | cooccurence:766 textmining:870 |
Rv3293 pcd |
piperideine-6-carboxylic acid dehydrogenase | 532 | 532 ctx | neighborhood:531 |
Rv1631 coaE |
dephospho-CoA kinase CoaE | 555 | 513 | coexpression:471 |
Rv3294c hyp |
hypothetical protein | 493 | 494 ctx | neighborhood:491 |
Rv2090 |
5'-3' exonuclease | 478 | 446 | coexpression:427 |
Rv1870c hyp |
hypothetical protein | 449 | 418 | coexpression:418 |
Rv1156 hyp |
hypothetical protein | 446 | 415 | coexpression:415 |
Rv3674c nth |
endonuclease III | 924 | 414 | coexpression:414 textmining:877 |
Rv1407 fmu |
16S rRNA m5C967 methyltransferase | 404 | 405 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: endonuclease VIII
- MTBC0 PGAP product: endonuclease VIII Nei2
- Pfam (hmmscan --cut_ga): Fapy_DNA_glyco PF01149.30 (E=2e-12), H2TH PF06831.20 (E=4e-10)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217814.1)
- Domains: Pfam-A via hmmscan --cut_ga — Fapy_DNA_glyco (PF01149.30), H2TH (PF06831.20)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0266 - Curated reference: UniProt P9WNC1 (SwissProt, reviewed; Inferred from homology)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 95.6)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
23 functional partner(s); context anchor
lhr - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003505|Rv3297|nei MPEGDTVWHTAATLRRHLAGRTLTRCDIRVPRFAAVDLTGEVVDEVISRGKHLFIRTGTASIHSHLQMDGSWRVGNRPVRVDHRARIILEANQQEQAIRVVGVDLGLLEVIDRHNDGAVVAHLGPDLLADDWDPQRAAANLIVAPDRPIAEALLDQRVLAGIGNVYCNELCFVSGVLPTAPVSAVADPRRLVTRARDMLWVNRFRWNRCTTGDTRAGRRLWVYGRAGQGCRRCGTLIAYDTTDERVRYWCPACQR
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for nei? Email the maintainer — the message is pre-filled with this gene's details.