nei Resolved · high auto-curated

H37Rv Rv3297 · MTBC0 mtbc0_003505 · 255 aa · 3703400–3704167 (+) · RefSeq NP_217814.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)endonuclease VIII
MTBC0 PGAP re-annotationendonuclease VIII Nei2
Revised (this work)Endonuclease VIII Nei2. Pfam: Fapy_DNA_glyco (PF01149.30), H2TH (PF06831.20).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WNC1 SwissProt · reviewed · Inferred from homology
UniProt nameEndonuclease 8 2
EC (curated) EC 3.2.2.-, EC 4.2.99.18
Curated functionInvolved in base excision repair of DNA damaged by oxidation or by mutagenic agents. Acts as a DNA glycosylase that recognizes and removes damaged bases. Has AP (apurinic/apyrimidinic) lyase activity and introduces nicks in the DNA strand. Cleaves the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates (By similarity). Complements an E.coli nei nth double mutant.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category L Replication, recombination and repair
Preferred namenei
eggNOG descriptionBelongs to the FPG family
Orthologous groupCOG0266
EC number EC 4.2.99.18
KEGG orthology K05522
KEGG pathways map03410
Gene Ontology (35) GO:0003674, GO:0003676, GO:0003677, GO:0003690, GO:0003824, GO:0005488, GO:0006139, GO:0006259, GO:0006281, GO:0006725, GO:0006807, GO:0006950 +23 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.066 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Fapy_DNA_glycoPF01149.30 2.0e-121–93 Formamidopyrimidine-DNA glycosylase N-terminal domain
H2THPF06831.20 3.6e-10123–186 Formamidopyrimidine-DNA glycosylase H2TH domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: lhr (ATP-dependent helicase), high confidence from genomic context alone (score 985 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3296 lhr ATP-dependent helicase 996 985 ctx neighborhood:881 coexpression:839 textmining:803
Rv2464c nei1 DNA glycosylase 924 924 database:900
Rv3555c hyp hypothetical protein 820 820 coexpression:817
Rv3295 TetR family transcriptional regulator 819 819 ctx neighborhood:818
Rv1629 polA DNA polymerase I 864 815 coexpression:790
Rv2191 hyp hypothetical protein 834 803 coexpression:797
Rv0944 fpg2 formamidopyrimidine-DNA glycosylase 968 766 ctx cooccurence:766 textmining:870
Rv3293 pcd piperideine-6-carboxylic acid dehydrogenase 532 532 ctx neighborhood:531
Rv1631 coaE dephospho-CoA kinase CoaE 555 513 coexpression:471
Rv3294c hyp hypothetical protein 493 494 ctx neighborhood:491
Rv2090 5'-3' exonuclease 478 446 coexpression:427
Rv1870c hyp hypothetical protein 449 418 coexpression:418
Rv1156 hyp hypothetical protein 446 415 coexpression:415
Rv3674c nth endonuclease III 924 414 coexpression:414 textmining:877
Rv1407 fmu 16S rRNA m5C967 methyltransferase 404 405

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: endonuclease VIII
  • MTBC0 PGAP product: endonuclease VIII Nei2
  • Pfam (hmmscan --cut_ga): Fapy_DNA_glyco PF01149.30 (E=2e-12), H2TH PF06831.20 (E=4e-10)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217814.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Fapy_DNA_glyco (PF01149.30), H2TH (PF06831.20)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0266
  • Curated reference: UniProt P9WNC1 (SwissProt, reviewed; Inferred from homology)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 23 functional partner(s); context anchor lhr
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003505|Rv3297|nei
MPEGDTVWHTAATLRRHLAGRTLTRCDIRVPRFAAVDLTGEVVDEVISRGKHLFIRTGTASIHSHLQMDGSWRVGNRPVRVDHRARIILEANQQEQAIRVVGVDLGLLEVIDRHNDGAVVAHLGPDLLADDWDPQRAAANLIVAPDRPIAEALLDQRVLAGIGNVYCNELCFVSGVLPTAPVSAVADPRRLVTRARDMLWVNRFRWNRCTTGDTRAGRRLWVYGRAGQGCRRCGTLIAYDTTDERVRYWCPACQR