accE5 Family assigned · medium auto-curated
H37Rv Rv3281 · MTBC0 mtbc0_003489 ·
156 aa · 3685832–3686302 (+) ·
RefSeq NP_217798.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | bifunctional protein acetyl-/propionyl-CoAcarboxylase subunit epsilon AccE |
|---|---|
| MTBC0 PGAP re-annotation | acyl-CoA carboxylase subunit epsilon |
| Revised (this work) | Acyl-CoA carboxylase subunit epsilon. Pfam: ACC_epsilon (PF13822.12). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P96886
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Biotin-dependent acetyl-/propionyl-coenzyme A carboxylase epsilon subunit |
| Curated function | Stimulates activity of the AccA3/AccD5 biotin-dependent acyl-CoA carboxylase complex. Interacts with AccD5 and modulates its carboxylase activity for acetyl-CoA and propionyl-CoA. Inhibits activity of the AccA3/AccD6 complex. Is also required for the activity of the long-chain acyl-CoA carboxylase (LCC) complex. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Acyl-CoA carboxylase epsilon subunit |
| Orthologous group | 2B02F |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.152 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 1 missense, 0 nonsense, 1 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.75% of strains (1087) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
ACC_epsilon | PF13822.12 | 1.5e-14 | 91–141 | Acyl-CoA carboxylase epsilon subunit |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: accD5 (propionyl-CoA carboxylase subunit beta), high confidence from genomic context alone (score 970 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3280 accD5 |
propionyl-CoA carboxylase subunit beta | 996 | 970 ctx | neighborhood:881 database:720 textmining:901 |
Rv3285 accA3 |
bifunctional protein acetyl-/propionyl-CoA carboxylase subunit alpha AccA | 990 | 884 ctx | neighborhood:597 database:720 textmining:922 |
Rv3282 hyp |
hypothetical protein | 958 | 884 ctx | neighborhood:882 textmining:653 |
Rv3284 hyp |
hypothetical protein | 824 | 825 ctx | neighborhood:822 |
Rv3283 sseA |
thiosulfate sulfurtransferase SseA | 823 | 823 ctx | neighborhood:822 |
Rv3279c birA |
bifunctional biotin operon repressor/biotin--[acetyl-CoA-carboxylase | 864 | 767 ctx | neighborhood:766 textmining:441 |
Rv3799c accD4 |
propionyl-CoA carboxylase subunit beta AccD | 897 | 754 | database:720 textmining:601 |
Rv3278c |
transmembrane protein | 752 | 752 ctx | neighborhood:748 |
Rv2247 accD6 |
acetyl-/propionyl-CoA carboxylase subunit beta | 893 | 743 | database:720 textmining:603 |
Rv0685 tuf |
elongation factor Tu | 733 | 733 | coexpression:733 |
Rv2501c accA1 |
acetyl/propionyl-CoA carboxylase subuit alpha | 877 | 529 | database:500 textmining:750 |
Rv0904c accD3 |
acetyl-CoAcarboxylase carboxyl transferase subunit beta | 661 | 360 | textmining:493 |
Rv0637 hadC |
(3R)-hydroxyacyl-ACP dehydratase subunit HadC | 404 | 252 | |
Rv2502c accD1 |
acetyl-/propionyl-CoA carboxylase subunit beta | 716 | 93 | textmining:700 |
Rv2524c fas |
fatty acid synthase | 592 | 47 | textmining:590 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: bifunctional protein acetyl-/propionyl-CoAcarboxylase subunit epsilon AccE
- MTBC0 PGAP product: acyl-CoA carboxylase subunit epsilon
- Pfam (hmmscan --cut_ga): ACC_epsilon PF13822.12 (E=1e-14)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217798.1)
- Domains: Pfam-A via hmmscan --cut_ga — ACC_epsilon (PF13822.12)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2B02F - Curated reference: UniProt P96886 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
19 functional partner(s); context anchor
accD5 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003489|Rv3281|accE5 MGTCPCESSERNEPVSRVSGTNEVSDGNETNNPAEVSDGNETNNPAEVSDGNETNNPAPVSRVSGTNEVSDGNETNNPAPVTEKPLHPHEPHIEILRGQPTDQELAALIAVLGSISGSTPPAQPEPTRWGLPVDQLRYPVFSWQRITLQEMTHMRR