lpqC Family assigned · medium auto-curated

H37Rv Rv3298c · MTBC0 mtbc0_003506 · 304 aa · 3704190–3705104 MTBC0 (-) · RefSeq NP_217815.1

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)esterase LpqC
MTBC0 PGAP re-annotationPHB depolymerase family esterase
Revised (this work)PHB depolymerase family esterase. Pfam: Peptidase_S9 (PF00326.28).
Functional category (TubercuList)cell wall and cell processes

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) never studied

No publication mentions this gene in its title or abstract — not under its H37Rv locus tag, not under its gene name, and not under any ortholog identifier. Its annotation rests on sequence/structure evidence, with no primary study behind it.

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

CRISPRi vulnerability

Vulnerability index 0.91 (95% CI -0.60 to 3.21). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionFunction unknown; lipolytic enzyme involved in cellular metabolism.
Mycobrowser EC 3.1.-.-

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb3326c · 100.0% identity
M. leprae ML0715 · 72.0% identity
M. marinum MMAR_1236 · 71.8% identity
M. smegmatis MSMEG_3463 · 56.8% identity
M. orygis RJtmp_003398 · 100.0% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P96903 TrEMBL · unreviewed · Evidence at protein level
UniProt namePossible esterase lipoprotein LpqC

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category Q Secondary metabolites biosynthesis, transport and catabolism
Preferred namelpqC
eggNOG descriptionesterase
Orthologous groupCOG3509
KEGG orthology K03932
CAZy family CE1

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Actinomycetia

M. canettii dN/dS (deep-divergence selection) 0.0 (low power) · 2 consensus substitution(s)
low power (2 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 53/53 (100%) · mean identity 67.2% · 4/4 closest MTBAP relatives
conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 2/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 31.0%
detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 13 in the ORF — 0 in the essential state, 0 growth-defect, 13 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 166.307692308. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) detected

MS detectiondetected in 10 of 16 independent MS datasets
Integrated abundance16.9 ppm · rank 2428/3519 (31.0th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Predicted localisation (DeepTMHMM + lipobox) lipoprotein

Predictionpredicted lipoprotein (lipobox + signal peptide)
DeepTMHMM classSP
Lipoboxsignal-peptidase-II lipobox; lipidated Cys near position 19

Transmembrane topology and signal peptide from DeepTMHMM (deep-learning reference predictor); lipoproteins from a (myco)bacterial lipobox motif. A sequence-based prediction of subcellular context.

Physico-chemical properties (computed, ProtParam)

Length304 aa
Molecular weight31.4 kDa
Theoretical pI5.45
GRAVY0.126 (hydrophobic)
Aliphatic index84.8
Aromaticity0.072
Instability index32.5 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Peptidase_S9PF00326.28 8.7e-05117–167 Prolyl oligopeptidase family

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 92.7

PDB hitprobTM-scoreE-valueDescription
8daj-assembly1_A 1.00 0.66 4.3e-15 sig 8daj-assembly1_A Structure and Biochemistry of a Promiscuous Thermophilic Polyhydroxybutyrate Depolymerase from Lihuaxuella thermophilia
9byu-assembly1_A 1.00 0.68 4.8e-15 sig 9byu-assembly1_A Structure and stability of an apo thermophilic esterase that hydrolyzes polyhydroxybutyrate
3wyd-assembly1_B 1.00 0.79 5.3e-09 sig 3wyd-assembly1_B C-terminal esterase domain of LC-Est1
5x6s-assembly1_B 1.00 0.59 8.9e-11 sig 5x6s-assembly1_B Acetyl xylan esterase from Aspergillus awamori
3doh-assembly1_A 1.00 0.66 2.1e-09 sig 3doh-assembly1_A Crystal Structure of a Thermostable Esterase

Foldseek search of the AlphaFold DB model (mean pLDDT 92.7, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 4

Upstream (5' on genome)nei (+ strand, 22 bp gap)
Downstream (3' on genome)atsB (- strand, 26 bp gap)
Predicted operon lpqC · atsB · Rv3300c · phoY1

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: atsB (arylsulfatase AtsB), high confidence from genomic context alone (score 762 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3299c atsB arylsulfatase AtsB 762 762 ctx neighborhood:703
Rv3300c hyp hypothetical protein 953 677 ctx neighborhood:660 textmining:861
Rv3301c phoY1 phosphate transport system transcriptional regulator PhoY 874 650 ctx neighborhood:640 textmining:656
Rv3302c glpD2 glycerol-3-phosphate dehydrogenase 753 475 ctx neighborhood:450 textmining:551
Rv0519c exp membrane protein 441 442 experimental:420
Rv3303c lpdA NAD(P)H quinone reductase LpdA 670 437 ctx neighborhood:427 textmining:437
Rv3304 hyp hypothetical protein 751 313 textmining:653
Rv2601 speE spermidine synthase 541 50 textmining:537
Rv3185 Probable transposase; Rv3185, (MTV014.29), len: 328 aa. Probable IS6110 transposase. Identical to many other M. tuberculosis IS6110 transpos 438 47 textmining:435

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: esterase LpqC
  • MTBC0 PGAP product: PHB depolymerase family esterase
  • Pfam (hmmscan --cut_ga): Peptidase_S9 PF00326.28 (E=9e-05)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217815.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Peptidase_S9 (PF00326.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3509
  • Curated reference: UniProt P96903 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 92.7)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 9 functional partner(s); context anchor atsB
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Predicted localisation: DeepTMHMM (Hallgren et al. 2022, doi:10.1101/2022.04.08.487609) for transmembrane topology and signal peptide; (myco)bacterial lipobox (Sutcliffe & Harrington 2004, doi:10.1099/mic.0.26804-0)
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003506|Rv3298c|lpqC
MPWARMLSLIVLMVCLAGCGGDQLLARHASSVATFQFGGLTRSYRLHVPPAEPSGLVISLHGGGGTGAGQEALTDFDAVADAADLLVVYPDGYDKSWADGRGASPADRRHLDDVGFLVALAAKLVHDFDIAPGHVFATGMSNGGFMSNRLACDRADIFAAVAPVAGTLGVGVTCNPSRPVSVLEAHGTADPLVPFNGGAVRGRGGLSHSISVASLVDRWRAVDGCQGDPSAAELPDVGDGTMVHLFDSSSCAAGTEVISYQIDNGGHTWPGGRQYLPKAVIGATTRAFDGSQVIAQFFATHGRD