lpqC Family assigned · medium auto-curated

H37Rv Rv3298c · MTBC0 mtbc0_003506 · 304 aa · 3704190–3705104 (-) · RefSeq NP_217815.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)esterase LpqC
MTBC0 PGAP re-annotationPHB depolymerase family esterase
Revised (this work)PHB depolymerase family esterase. Pfam: Peptidase_S9 (PF00326.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P96903 TrEMBL · unreviewed · Evidence at protein level
UniProt namePossible esterase lipoprotein LpqC

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category Q Secondary metabolites biosynthesis, transport and catabolism
Preferred namelpqC
eggNOG descriptionesterase
Orthologous groupCOG3509
KEGG orthology K03932
CAZy family CE1

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Peptidase_S9PF00326.28 8.7e-05117–167 Prolyl oligopeptidase family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: atsB (arylsulfatase AtsB), high confidence from genomic context alone (score 762 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3299c atsB arylsulfatase AtsB 762 762 ctx neighborhood:703
Rv3300c hyp hypothetical protein 953 677 ctx neighborhood:660 textmining:861
Rv3301c phoY1 phosphate transport system transcriptional regulator PhoY 874 650 ctx neighborhood:640 textmining:656
Rv3302c glpD2 glycerol-3-phosphate dehydrogenase 753 475 ctx neighborhood:450 textmining:551
Rv0519c membrane protein 441 442 experimental:420
Rv3303c lpdA NAD(P)H quinone reductase LpdA 670 437 ctx neighborhood:427 textmining:437
Rv3304 hyp hypothetical protein 751 313 textmining:653
Rv2601 speE spermidine synthase 541 50 textmining:537
Rv3185 Probable transposase; Rv3185, (MTV014.29), len: 328 aa. Probable IS6110 transposase. Identical to many other M. tuberculosis IS6110 transpos 438 47 textmining:435

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: esterase LpqC
  • MTBC0 PGAP product: PHB depolymerase family esterase
  • Pfam (hmmscan --cut_ga): Peptidase_S9 PF00326.28 (E=9e-05)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217815.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Peptidase_S9 (PF00326.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3509
  • Curated reference: UniProt P96903 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 9 functional partner(s); context anchor atsB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003506|Rv3298c|lpqC
MPWARMLSLIVLMVCLAGCGGDQLLARHASSVATFQFGGLTRSYRLHVPPAEPSGLVISLHGGGGTGAGQEALTDFDAVADAADLLVVYPDGYDKSWADGRGASPADRRHLDDVGFLVALAAKLVHDFDIAPGHVFATGMSNGGFMSNRLACDRADIFAAVAPVAGTLGVGVTCNPSRPVSVLEAHGTADPLVPFNGGAVRGRGGLSHSISVASLVDRWRAVDGCQGDPSAAELPDVGDGTMVHLFDSSSCAAGTEVISYQIDNGGHTWPGGRQYLPKAVIGATTRAFDGSQVIAQFFATHGRD