usfY Family assigned · low

H37Rv Rv3288c · MTBC0 - · 137 aa · 3669586–3669999 (-) · RefSeq NP_217805.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)UsfY, an open reading frame of the sigF gene cluster, located immediately upstream of usfX-sigF (the stress/stationary-phase sigma factor and its anti-sigma factor). UsfY has no significant homologues and may not be co-transcribed with usfX-sigF; molecular function unknown but its genomic context ties it to the SigF stress-response locus.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt L7N685 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProtein USFY

Functional vocabulary (eggNOG-mapper, orthology transfer)

Preferred nameusfY
Orthologous group2B4VS

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.356 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 82.0 (confident). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
6s7o-assembly1_F 0.25 0.42 2.3e+00 6s7o-assembly1_F Cryo-EM structure of human oligosaccharyltransferase complex OST-A
7o3x-assembly1_E 0.14 0.46 7.8e+00 7o3x-assembly1_E Structural basis for VIPP1 oligomerization and maintenance of thylakoid membrane integrity

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv3289c (transmembrane protein), high confidence from genomic context alone (score 968 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3289c transmembrane protein 967 968 ctx neighborhood:817 coexpression:831
Rv3290c lat L-lysine-epsilon aminotransferase 945 946 ctx neighborhood:657 coexpression:848
Rv3287c rsbW anti-sigma factor RsbW 858 853 ctx neighborhood:463 coexpression:738
Rv3286c sigF RNA polymerase sigma factor SigF 805 805 ctx neighborhood:701
Rv3291c lrpA transcriptional regulator LrpA 551 551 ctx neighborhood:534
Rv3292 hyp hypothetical protein 437 437 ctx neighborhood:406
Rv3293 pcd piperideine-6-carboxylic acid dehydrogenase 416 416
Rv0188 transmembrane protein 639 76 textmining:626
Rv2558 hyp hypothetical protein 808 70 textmining:803
Rv2557 hyp hypothetical protein 542 65 textmining:531
Rv2660c hyp hypothetical protein 664 53 textmining:660
Rv1954c hyp hypothetical protein 633 49 textmining:630
Rv1285 cysD sulfate adenylyltransferase subunit 2 438 49 textmining:434
Rv0723 rplO 50S ribosomal protein L15 729 46 textmining:729
Rv3661 hyp hypothetical protein 549 46 textmining:547

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Member of the sigF gene cluster (upstream of usfX-sigF); named usfY (DeMaio 1997, PMID 9666957)
  • Curated from the literature crible (project 'Still unknown gene function', 2026-06-09)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217805.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2B4VS
  • Curated reference: UniProt L7N685 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 82.0, confident)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 19 functional partner(s); context anchor Rv3289c
  • Primary literature: DeMaio J, Zhang Y, Ko C, Bishai WR (1997). Mycobacterium tuberculosis sigF is part of a gene cluster with similarities to the Bacillus subtilis sigF and sigB operons Tuber Lung Dis 78(1):3-12. doi:10.1016/s0962-8479(97)90010-1 PMID:9666957

Ancestral MTBC0 protein sequence

>H37Rv|Rv3288c|usfY
MGQIPPQPVRRVLPLMVVPGNGQKWRNRTETEEAMGDTYRDPVDHLRTTRPLAGESLIDVVHWPGYLLIVAGVVGGVGALAAFGTGHHAEGMTFGVVAIVVTVVGLAWLAFEHRRIRKIADRWYTEHPEVRRQRLAG