Rv2738c Family assigned · low

H37Rv Rv2738c · MTBC0 mtbc0_002913 · 68 aa · 3074221–3074427 (-) · RefSeq NP_217254.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationDUF3046 domain-containing protein
Revised (this work)Psp-like envelope-stress system protein (paralogue of the Rv2742c Psp module). RefSeq leaves it 'hypothetical protein'.

Curated reference (UniProt)

UniProt I6YA47 TrEMBL · unreviewed · Evidence at protein level
UniProt nameDUF3046 domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionProtein of unknown function (DUF3046)
Orthologous group2EFU9

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF3046PF11248.14 1.7e-285–65 Protein of unknown function (DUF3046)

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 79.8 (confident). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
6u8q-assembly1_L 0.06 0.40 4.2e+00 6u8q-assembly1_L CryoEM structure of HIV-1 cleaved synaptic complex (CSC) intasome
3ao4-assembly1_A 0.06 0.38 4.5e+00 3ao4-assembly1_A Fragment-based approach to the design of ligands targeting a novel site on HIV-1 integrase
6put-assembly1_B-2 0.06 0.35 3.7e+00 6put-assembly1_B-2 Structure of HIV cleaved synaptic complex (CSC) intasome bound with calcium
1exq-assembly1_A 0.05 0.39 5.5e+00 1exq-assembly1_A CRYSTAL STRUCTURE OF THE HIV-1 INTEGRASE CATALYTIC CORE DOMAIN
9c9m-assembly1_B 0.05 0.33 3.3e+00 9c9m-assembly1_B HIV-1 intasome core bound with DTG
6puy-assembly1_B 0.05 0.35 4.5e+00 6puy-assembly1_B Structure of HIV cleaved synaptic complex (CSC) intasome bound with magnesium and INSTI XZ426 (compound 4d)
1k6y-assembly1_D 0.04 0.42 7.6e+00 1k6y-assembly1_D Crystal Structure of a Two-Domain Fragment of HIV-1 Integrase
6puz-assembly1_B-2 0.04 0.36 5.5e+00 6puz-assembly1_B-2 Structure of HIV cleaved synaptic complex (CSC) intasome bound with magnesium and INSTI XZ446 (compound 4f)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2739c (transferase), high confidence from genomic context alone (score 885 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2739c transferase 884 885 ctx neighborhood:879
Rv2740 ephG epoxide hydrolase 788 788 ctx neighborhood:787
Rv2736c recX regulatory protein RecX 546 546 ctx neighborhood:544
Rv2737c recA recombinase A 541 541 ctx neighborhood:541
Rv3416 whiB3 redox-responsive transcriptional regulator WhiB3 465 465 ctx cooccurence:465
Rv0880 HTH-type transcriptional regulator 449 450 ctx cooccurence:448
Rv0011c crgA cell division protein CrgA 436 437 ctx cooccurence:436
Rv2412 rpsT 30S ribosomal protein S20 871 55 textmining:870
Rv3908 mutT4 mutator protein MutT 805 54 textmining:803
Rv1321 nucS endonuclease NucS 870 47 textmining:870
Rv2645 hyp hypothetical protein 810 46 textmining:810
Rv3221c TB7.3 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit 806 46 textmining:805
Rv3018c PPE46 PPE family protein PPE46 521 45 textmining:519
Rv0387c Rv0387c, (MTV036.22c), len: 244 aa. Conserved hypothetical protein, showing some similarity to MTCI237.20c, and M17282|HUMEL20_1 Human elast 520 44 textmining:519
Rv3022c PPE48 Rv3021c, (MTV012.35c), len: 358 aa. PPE47, Member of Mycobacterium tuberculosis PPE family. Should be continuation of upstream ORF MTV012.36 511 42 textmining:511

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Foldseek vs AFDB-SwissProt: envelope-preserving system protein Rv2742c, TM 0.92, E 5e-3
  • Structural homology vs AlphaFold-Swiss-Prot (Foldseek; 542k curated SwissProt structures), project 'Still unknown gene function' phase13, 2026-06-10. Fold/family-level, not a demonstrated function.

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217254.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF3046 (PF11248.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2EFU9
  • Curated reference: UniProt I6YA47 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 79.8, confident)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 16 functional partner(s); context anchor Rv2739c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002913|Rv2738c|
MLAGVRLTEFHERVALHFGAAYGSSVLLDHVLTGFDGRSAAQAIEDGVEPRDVWRALCADFDVPHDRW