rpsT Resolved · high auto-curated
H37Rv Rv2412 · MTBC0 mtbc0_002568 ·
86 aa · 2734343–2734603 (+) ·
RefSeq NP_216928.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | 30S ribosomal protein S20 |
|---|---|
| MTBC0 PGAP re-annotation | 30S ribosomal protein S20 |
| Revised (this work) | 30S ribosomal protein S20. Pfam: Ribosomal_S20p (PF01649.24). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WH41
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Small ribosomal subunit protein bS20 |
| Curated function | Binds directly to 16S ribosomal RNA. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
J Translation, ribosomal structure and biogenesis
|
|---|---|
| Preferred name | rpsT |
| eggNOG description | Binds directly to 16S ribosomal RNA |
| Orthologous group | COG0268 |
| KEGG orthology |
K02968
|
| KEGG pathways |
map03010
|
| KEGG modules |
M00178
|
| Gene Ontology (10) |
GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0008150, GO:0040007, GO:0044424, GO:0044444, GO:0044464
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Ribosomal_S20p | PF01649.24 | 1.8e-29 | 2–84 | Ribosomal protein S20 |
Functional interaction network (STRING v12, guilt-by-association)
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0053 rpsF |
30S ribosomal protein S6 | 999 | 1000 | coexpression:752 experimental:999 textmining:404 |
Rv2904c rplS |
50S ribosomal protein L19 | 999 | 1000 | coexpression:784 experimental:999 |
Rv0055 rpsR1 |
30S ribosomal protein S18 | 999 | 1000 | coexpression:711 experimental:999 textmining:666 |
Rv3924c rpmH |
50S ribosomal protein L34 | 999 | 1000 | coexpression:661 experimental:999 |
Rv0718 rpsH |
30S ribosomal protein S8 | 999 | 1000 | coexpression:568 experimental:999 |
Rv0683 rpsG |
30S ribosomal protein S7 | 999 | 1000 | coexpression:656 experimental:999 |
Rv3458c rpsD |
30S ribosomal protein S4 | 999 | 1000 | coexpression:769 experimental:999 |
Rv1642 rpmI |
50S ribosomal protein L35 | 999 | 1000 | coexpression:651 experimental:999 |
Rv0701 rplC |
50S ribosomal protein L3 | 999 | 1000 | coexpression:665 experimental:999 |
Rv2909c rpsP |
30S ribosomal protein S16 | 999 | 1000 | coexpression:861 experimental:999 textmining:420 |
Rv0714 rplN |
50S ribosomal protein L14 | 999 | 1000 | coexpression:670 experimental:999 textmining:570 |
Rv2785c rpsO |
30S ribosomal protein S15 | 999 | 1000 | coexpression:846 experimental:999 textmining:511 |
Rv3461c rpmJ |
50S ribosomal protein L36 | 999 | 1000 | coexpression:653 experimental:999 |
Rv0710 rpsQ |
30S ribosomal protein S17 | 999 | 1000 | coexpression:655 experimental:999 |
Rv3459c rpsK |
30S ribosomal protein S11 | 999 | 1000 | coexpression:628 experimental:999 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: 30S ribosomal protein S20
- MTBC0 PGAP product: 30S ribosomal protein S20
- Pfam (hmmscan --cut_ga): Ribosomal_S20p PF01649.24 (E=2e-29)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216928.1)
- Domains: Pfam-A via hmmscan --cut_ga — Ribosomal_S20p (PF01649.24)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0268 - Curated reference: UniProt P9WH41 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 139 functional partner(s)
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002568|Rv2412|rpsT MANIKSQQKRNRTNERARLRNKAVKSSLRTAVRAFREAAHAGDKAKAAELLASTNRKLDKAASKGVIHKNQAANKKSALAQALNKL