rpsT Resolved · high auto-curated

H37Rv Rv2412 · MTBC0 mtbc0_002568 · 86 aa · 2734343–2734603 (+) · RefSeq NP_216928.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)30S ribosomal protein S20
MTBC0 PGAP re-annotation30S ribosomal protein S20
Revised (this work)30S ribosomal protein S20. Pfam: Ribosomal_S20p (PF01649.24).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WH41 SwissProt · reviewed · Evidence at protein level
UniProt nameSmall ribosomal subunit protein bS20
Curated functionBinds directly to 16S ribosomal RNA.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred namerpsT
eggNOG descriptionBinds directly to 16S ribosomal RNA
Orthologous groupCOG0268
KEGG orthology K02968
KEGG pathways map03010
KEGG modules M00178
Gene Ontology (10) GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0008150, GO:0040007, GO:0044424, GO:0044444, GO:0044464

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Ribosomal_S20pPF01649.24 1.8e-292–84 Ribosomal protein S20

Functional interaction network (STRING v12, guilt-by-association)

PartnerProductScoreNo text-miningChannels (≥400)
Rv0053 rpsF 30S ribosomal protein S6 999 1000 coexpression:752 experimental:999 textmining:404
Rv2904c rplS 50S ribosomal protein L19 999 1000 coexpression:784 experimental:999
Rv0055 rpsR1 30S ribosomal protein S18 999 1000 coexpression:711 experimental:999 textmining:666
Rv3924c rpmH 50S ribosomal protein L34 999 1000 coexpression:661 experimental:999
Rv0718 rpsH 30S ribosomal protein S8 999 1000 coexpression:568 experimental:999
Rv0683 rpsG 30S ribosomal protein S7 999 1000 coexpression:656 experimental:999
Rv3458c rpsD 30S ribosomal protein S4 999 1000 coexpression:769 experimental:999
Rv1642 rpmI 50S ribosomal protein L35 999 1000 coexpression:651 experimental:999
Rv0701 rplC 50S ribosomal protein L3 999 1000 coexpression:665 experimental:999
Rv2909c rpsP 30S ribosomal protein S16 999 1000 coexpression:861 experimental:999 textmining:420
Rv0714 rplN 50S ribosomal protein L14 999 1000 coexpression:670 experimental:999 textmining:570
Rv2785c rpsO 30S ribosomal protein S15 999 1000 coexpression:846 experimental:999 textmining:511
Rv3461c rpmJ 50S ribosomal protein L36 999 1000 coexpression:653 experimental:999
Rv0710 rpsQ 30S ribosomal protein S17 999 1000 coexpression:655 experimental:999
Rv3459c rpsK 30S ribosomal protein S11 999 1000 coexpression:628 experimental:999

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: 30S ribosomal protein S20
  • MTBC0 PGAP product: 30S ribosomal protein S20
  • Pfam (hmmscan --cut_ga): Ribosomal_S20p PF01649.24 (E=2e-29)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216928.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Ribosomal_S20p (PF01649.24)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0268
  • Curated reference: UniProt P9WH41 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 139 functional partner(s)
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002568|Rv2412|rpsT
MANIKSQQKRNRTNERARLRNKAVKSSLRTAVRAFREAAHAGDKAKAAELLASTNRKLDKAASKGVIHKNQAANKKSALAQALNKL